Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged IL23R is 0.03 ng/ml as a capture antibody.)

Mouse IL23R Monoclonal Antibody | anti-IL23R antibody

IL23R (Interleukin 23 Receptor) (HRP)

Applications
Western Blot
Purity
Purified
Synonyms
IL23R; Monoclonal Antibody; IL23R (Interleukin 23 Receptor) (HRP); Interleukin 23 Receptor; anti-IL23R antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1G12
Specificity
Recognizes IL23R.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-IL23R antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
IL23R (NP_653302, 553aa-628aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LNQGECSSPDIQNSVEEETTMLLENDSPSETIPEQTLLPDEFVSCLGIVNEELPSINTYFPQNILESHFNRISLLE
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged IL23R is 0.03 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged IL23R is 0.03 ng/ml as a capture antibody.)
Product Categories/Family for anti-IL23R antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
65.3kDa (574aa) 70-100kDa (SDS-PAGE under reducing conditions)
NCBI Official Full Name
interleukin-23 receptor
NCBI Official Synonym Full Names
interleukin 23 receptor
NCBI Official Symbol
IL23R
NCBI Protein Information
interleukin-23 receptor
UniProt Protein Name
Interleukin-23 receptor
Protein Family
UniProt Gene Name
IL23R
UniProt Synonym Gene Names
IL-23 receptor; IL-23R
UniProt Entry Name
IL23R_HUMAN

NCBI Description

The protein encoded by this gene is a subunit of the receptor for IL23A/IL23. This protein pairs with the receptor molecule IL12RB1/IL12Rbeta1, and both are required for IL23A signaling. This protein associates constitutively with Janus kinase 2 (JAK2), and also binds to transcription activator STAT3 in a ligand-dependent manner. [provided by RefSeq, Jul 2008]

Uniprot Description

IL23R: Associates with IL12RB1 to form the interleukin-23 receptor. Binds IL23 and mediates T-cells, NK cells and possibly certain macrophage/myeloid cells stimulation probably through activation of the Jak-Stat signaling cascade. IL23 functions in innate and adaptive immunity and may participate in acute response to infection in peripheral tissues. IL23 may be responsible for autoimmune inflammatory diseases and be important for tumorigenesis. Genetic variations in IL23R are associated with inflammatory bowel disease type 17 (IBD17). IBD17 is a chronic, relapsing inflammation of the gastrointestinal tract with a complex etiology. It is subdivided into Crohn disease and ulcerative colitis phenotypes. Crohn disease may affect any part of the gastrointestinal tract from the mouth to the anus, but most frequently it involves the terminal ileum and colon. Bowel inflammation is transmural and discontinuous; it may contain granulomas or be associated with intestinal or perianal fistulas. In contrast, in ulcerative colitis, the inflammation is continuous and limited to rectal and colonic mucosal layers; fistulas and granulomas are not observed. Both diseases include extraintestinal inflammation of the skin, eyes, or joints. Genetic variations in IL23R are a cause of susceptibility to psoriasis type 7 (PSORS7). Psoriasis is a common, chronic inflammatory disease of the skin with multifactorial etiology. It is characterized by red, scaly plaques usually found on the scalp, elbows and knees. These lesions are caused by abnormal keratinocyte proliferation and infiltration of inflammatory cells into the dermis and epidermis. Belongs to the type I cytokine receptor family. Type 2 subfamily. 7 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 1p31.3

Cellular Component: receptor complex

Molecular Function: interleukin-23 binding; interleukin-23 receptor activity; interleukin-12 receptor binding

Biological Process: positive regulation of memory T cell differentiation; positive regulation of interleukin-17 production; positive regulation of granulocyte macrophage colony-stimulating factor production; positive regulation of NK T cell activation; positive regulation of natural killer cell proliferation; negative regulation of interleukin-10 production; positive regulation of T-helper 1 type immune response; positive regulation of osteoclast differentiation; positive regulation of interleukin-12 production; positive regulation of T cell mediated cytotoxicity; positive regulation of tyrosine phosphorylation of Stat4 protein; response to lipopolysaccharide; positive regulation of activated T cell proliferation; defense response to Gram-negative bacterium; regulation of tyrosine phosphorylation of Stat1 protein; positive regulation of tyrosine phosphorylation of Stat3 protein; positive regulation of interferon-gamma production; positive regulation of tyrosine phosphorylation of Stat5 protein; positive regulation of T cell proliferation; positive regulation of defense response to virus by host; inflammatory response

Disease: Inflammatory Bowel Disease 17; Psoriasis 7, Susceptibility To

Research Articles on IL23R

Similar Products

Product Notes

The IL23R il23r (Catalog #AAA6181344) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's IL23R can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IL23R il23r for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IL23R, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.