Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse IL1RL2 Monoclonal Antibody | anti-IL1RL2 antibody

IL1RL2 (Interleukin 1 Receptor-like 2, IL1R-rp2, IL1RRP2) (MaxLight 750)

Gene Names
IL1RL2; IL-36R; IL1RRP2; IL-1Rrp2; IL1R-rp2
Applications
Western Blot
Purity
Purified
Synonyms
IL1RL2; Monoclonal Antibody; IL1RL2 (Interleukin 1 Receptor-like 2; IL1R-rp2; IL1RRP2) (MaxLight 750); Interleukin 1 Receptor-like 2; IL1RRP2; anti-IL1RL2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
5G5
Specificity
Recognizes IL1RL2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-IL1RL2 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
IL1RL2 (NP_003845, 20aa-118aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DGCKDIFMKNEILSASQPFAFNCTFPPITSGEVSVTWYKNSSKIPVSKIIQSRIHQDETWILFLPMEWGDSGVYQCVIKGRDSCHRIHVNLTVFEKHWC
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-IL1RL2 antibody
The protein encoded by this gene is a member of the interleukin 1 receptor family. An experiment with transient gene expression demonstrated that this receptor was incapable of binding to interleukin 1 alpha and interleukin 1 beta with high affinity. This gene and four other interleukin 1 receptor family genes, including interleukin 1 receptor, type I (IL1R1), interleukin 1 receptor, type II (IL1R2), interleukin 1 receptor-like 1 (IL1RL1), and interleukin 18 receptor 1 (IL18R1), form a cytokine receptor gene cluster in a region mapped to chromosome 2q12. [provided by RefSeq]
Product Categories/Family for anti-IL1RL2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Predicted: 61 kDa

Observed: 55 kDa
NCBI Official Full Name
interleukin-1 receptor-like 2
NCBI Official Synonym Full Names
interleukin 1 receptor-like 2
NCBI Official Symbol
IL1RL2
NCBI Official Synonym Symbols
IL-36R; IL1RRP2; IL-1Rrp2; IL1R-rp2
NCBI Protein Information
interleukin-1 receptor-like 2; IL-36 receptor; IL-1 receptor-related protein 2; interleukin-1 receptor-related protein 2
UniProt Protein Name
Interleukin-1 receptor-like 2
Protein Family
UniProt Gene Name
IL1RL2
UniProt Synonym Gene Names
IL1RRP2; IL-36R; IL-1Rrp2; IL1R-rp2
UniProt Entry Name
ILRL2_HUMAN

NCBI Description

The protein encoded by this gene is a member of the interleukin 1 receptor family. An experiment with transient gene expression demonstrated that this receptor was incapable of binding to interleukin 1 alpha and interleukin 1 beta with high affinity. This gene and four other interleukin 1 receptor family genes, including interleukin 1 receptor, type I (IL1R1), interleukin 1 receptor, type II (IL1R2), interleukin 1 receptor-like 1 (IL1RL1), and interleukin 18 receptor 1 (IL18R1), form a cytokine receptor gene cluster in a region mapped to chromosome 2q12. [provided by RefSeq, Jul 2008]

Uniprot Description

IL1RL2: Receptor for interleukin 1 family member 9 (IL1F9). Binding to the agonist leads to the activation of NF-kappa-B. Belongs to the interleukin-1 receptor family.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 2q12

Cellular Component: integral to plasma membrane

Molecular Function: interleukin-1, Type I, activating receptor activity; interleukin-1 receptor activity

Biological Process: positive regulation of T cell differentiation; cytokine and chemokine mediated signaling pathway; regulation of inflammatory response; innate immune response; positive regulation of interleukin-6 production; cellular defense response; inflammatory response; signal transduction

Research Articles on IL1RL2

Similar Products

Product Notes

The IL1RL2 il1rl2 (Catalog #AAA6238916) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's IL1RL2 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IL1RL2 il1rl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IL1RL2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.