Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of IL1F8 expression in transfected 293T cell line by IL1F8 monoclonal antibody. Lane 1: IL1F8 transfected lysate (17.7kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human IL1F8 Monoclonal Antibody | anti-IL1F8 antibody

IL1F8 (Interleukin-1 Homolog 2, IL-1H2, FIL1 eta, Interleukin-1 eta, IL-1 eta, Interleukin-1 Family Member 8, IL-1F8, IL1F8, IL1H2, MGC126880, MGC126882) (HRP)

Gene Names
IL36B; FIL1; FIL1H; IL1F8; IL1H2; IL-1F8; IL-1H2; IL1-ETA; FIL1-(ETA); FILI-(ETA)
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
IL1F8; Monoclonal Antibody; IL1F8 (Interleukin-1 Homolog 2; IL-1H2; FIL1 eta; Interleukin-1 eta; IL-1 eta; Interleukin-1 Family Member 8; IL-1F8; IL1H2; MGC126880; MGC126882) (HRP); anti-IL1F8 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1E4
Specificity
Recognizes human IL1F8.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
157
Applicable Applications for anti-IL1F8 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full-length recombinant corresponding to aa1-157 from human IL1F8 (NP_775270) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MNPQREAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKEKNIMDLYVEKKAQKPFLFFHNKEGSTSVFQSVSYPGWFIATSTTSGQPIFLTKERGITNNTNFYLDSVE
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of IL1F8 expression in transfected 293T cell line by IL1F8 monoclonal antibody. Lane 1: IL1F8 transfected lysate (17.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of IL1F8 expression in transfected 293T cell line by IL1F8 monoclonal antibody. Lane 1: IL1F8 transfected lysate (17.7kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged IL1F8 is 0.1ng/ml as a capture antibody.Detection limit for recombinant GST tagged IL1F8 is 0.1ng/ml as a capture antibody. Detection limit for recombinant GST tagged IL1F8 is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged IL1F8 is 0.1ng/ml as a capture antibody.Detection limit for recombinant GST tagged IL1F8 is 0.1ng/ml as a capture antibody. Detection limit for recombinant GST tagged IL1F8 is 0.1ng/ml as a capture antibody.)
Related Product Information for anti-IL1F8 antibody
The protein is a member of the interleukin 1 cytokine family. Protein structure modeling indicated that this cytokine may contain a 12-stranded beta-trefoil structure that is conserved between IL1A (IL-A alpha) and IL1B (IL-1 beta).
Product Categories/Family for anti-IL1F8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
interleukin-36 beta isoform 2
NCBI Official Synonym Full Names
interleukin 36 beta
NCBI Official Symbol
IL36B
NCBI Official Synonym Symbols
FIL1; FIL1H; IL1F8; IL1H2; IL-1F8; IL-1H2; IL1-ETA; FIL1-(ETA); FILI-(ETA)
NCBI Protein Information
interleukin-36 beta
UniProt Protein Name
Interleukin-36 beta
UniProt Gene Name
IL36B
UniProt Synonym Gene Names
IL1F8; IL1H2; IL-1 eta; IL-1F8; IL-1H2
UniProt Entry Name
IL36B_HUMAN

NCBI Description

The protein encoded by this gene is a member of the interleukin 1 cytokine family. Protein structure modeling indicated that this cytokine may contain a 12-stranded beta-trefoil structure that is conserved between IL1A (IL-A alpha) and IL1B (IL-1 beta). This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Two alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]

Uniprot Description

IL36B: Stimulates production of interleukin-6 and interleukin-8 in synovial fibrobasts, articular chondrocytes and mature adipocytes. Induces expression of a number of antimicrobial peptides including beta-defensins 4 and 103 as well as a number of matrix metalloproteases. Belongs to the IL-1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cytokine

Chromosomal Location of Human Ortholog: 2q14

Cellular Component: extracellular space; extracellular region

Molecular Function: interleukin-1 receptor binding; cytokine activity

Biological Process: positive regulation of T cell differentiation; cytokine and chemokine mediated signaling pathway; innate immune response; positive regulation of interleukin-6 production; immune response; inflammatory response

Research Articles on IL1F8

Similar Products

Product Notes

The IL1F8 il36b (Catalog #AAA6153062) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The IL1F8 (Interleukin-1 Homolog 2, IL-1H2, FIL1 eta, Interleukin-1 eta, IL-1 eta, Interleukin-1 Family Member 8, IL-1F8, IL1F8, IL1H2, MGC126880, MGC126882) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IL1F8 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IL1F8 il36b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IL1F8, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.