Mouse anti-Human IL15RA Monoclonal Antibody | anti-IL15RA antibody

IL15RA (Interleukin-15 Receptor Subunit alpha, IL-15 Receptor Subunit alpha, IL-15R-alpha, IL-15RA, CD215, Soluble Interleukin-15 Receptor Subunit alpha, sIL-15 Receptor Subunit alpha, sIL-15R-alpha, sIL-15RA, MGC104179) (FITC)

Cat. Num. AAA6147752

• Gene Names: IL15RA; CD215
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: IL15RA; Monoclonal Antibody; IL15RA (Interleukin-15 Receptor Subunit alpha; IL-15 Receptor Subunit alpha; IL-15R-alpha; IL-15RA; CD215; Soluble Interleukin-15 Receptor Subunit alpha; sIL-15 Receptor Subunit alpha; sIL-15R-alpha; sIL-15RA; MGC104179) (FITC); anti-IL15RA antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 1C5
• Specificity: Recognizes human IL15RA.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-IL15RA antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa31-130 from human IL15RA (NP_002180) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPA
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Testing Data

(Detection limit for recombinant GST tagged IL15RA is 0.1ng/ml as a capture antibody.)

Related Product Information for anti-IL15RA antibody

This gene encodes a cytokine receptor that specifically binds interleukin 15 (IL15) with high affinity. The receptors of IL15 and IL2 share two subunits, IL2R beta and IL2R gamma. This forms the basis of many overlapping biological activities of IL15 and IL2. The protein encoded by this gene is structurally related to IL2R alpha, an additional IL2-specific alpha subunit necessary for high affinity IL2 binding. Unlike IL2RA, IL15RA is capable of binding IL15 with high affinity independent of other subunits, which suggests distinct roles between IL15 and IL2. This receptor is reported to enhance cell proliferation and expression of apoptosis inhibitor BCL2L1/BCL2-XL and BCL2. Multiple alternatively spliced transcript variants of this gene have been reported.

Product Categories/Family for anti-IL15RA antibody

Antibodies; Interleukin

NCBI and Uniprot Product Information

• NCBI GI #: 4504649
• NCBI GeneID: 3601
• NCBI Accession #: NP_002180
• NCBI GenBank Nucleotide #: NM_002189
• UniProt Accession #: Q13261; Q3B769; Q5JVA1; Q5JVA2; Q5JVA4; Q6B0J2; Q7LDR4; Q7Z609; B4E2C2
• Molecular Weight: 45.6kDa (417aa) 57-70KDa (SDS-PAGE under reducing conditions.)
• NCBI Official Full Name: interleukin-15 receptor subunit alpha isoform 1
• NCBI Official Synonym Full Names: interleukin 15 receptor subunit alpha
• NCBI Official Symbol: IL15RA
• NCBI Official Synonym Symbols: CD215
• NCBI Protein Information: interleukin-15 receptor subunit alpha
• UniProt Protein Name: Interleukin-15 receptor subunit alpha
• Protein Family: Interleukin-15 receptor
• UniProt Gene Name: IL15RA
• UniProt Synonym Gene Names: IL-15 receptor subunit alpha; IL-15R-alpha; IL-15RA; sIL-15 receptor subunit alpha; sIL-15R-alpha; sIL-15RA
• UniProt Entry Name: I15RA_HUMAN

NCBI Description

This gene encodes a cytokine receptor that specifically binds interleukin 15 (IL15) with high affinity. The receptors of IL15 and IL2 share two subunits, IL2R beta and IL2R gamma. This forms the basis of many overlapping biological activities of IL15 and IL2. The protein encoded by this gene is structurally related to IL2R alpha, an additional IL2-specific alpha subunit necessary for high affinity IL2 binding. Unlike IL2RA, IL15RA is capable of binding IL15 with high affinity independent of other subunits, which suggests distinct roles between IL15 and IL2. This receptor is reported to enhance cell proliferation and expression of apoptosis inhibitor BCL2L1/BCL2-XL and BCL2. Multiple alternatively spliced transcript variants of this gene have been reported.[provided by RefSeq, Apr 2010]

Uniprot Description

IL15RA: High-affinity receptor for interleukin-15. Can signal both in cis and trans where IL15R from one subset of cells presents IL15 to neighboring IL2RG-expressing cells. Expression of different isoforms may alter or interfere with signal transduction. Isoform 5, isoform 6, isoform 7 and isoform 8 do not bind IL15. Signal transduction involves STAT3, STAT5, STAT6, JAK2 and SYK. 8 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Receptor, cytokine

Chromosomal Location of Human Ortholog: 10p15.1

Cellular Component: Golgi membrane; extracellular space; endoplasmic reticulum membrane; nuclear membrane; cytoplasmic vesicle membrane; integral to membrane

Molecular Function: hematopoietin/interferon-class (D200-domain) cytokine receptor activity; signal transducer activity; protein binding

Biological Process: cell proliferation; cytokine and chemokine mediated signaling pathway; signal transduction