Mouse IKBKG Monoclonal Antibody | anti-IKBKG antibody

IKBKG (Inhibitor of kappa Light Polypeptide Gene Enhancer in B-Cells, Kinase gamma, AMCBX1, FIP-3, FIP3, Fip3p, IKK-gamma, IP, IP1, IP2, IPD2, NEMO) (Biotin)

Cat. Num. AAA6170624

• Gene Names: IKBKG; IP; IP1; IP2; FIP3; IKKG; IPD2; NEMO; FIP-3; Fip3p; IMD33; AMCBX1; EDAID1; IKKAP1; ZC2HC9; IKK-gamma
• Applications: Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: IKBKG; Monoclonal Antibody; IKBKG (Inhibitor of kappa Light Polypeptide Gene Enhancer in B-Cells; Kinase gamma; AMCBX1; FIP-3; FIP3; Fip3p; IKK-gamma; IP; IP1; IP2; IPD2; NEMO) (Biotin); Inhibitor of kappa Light Polypeptide Gene Enhancer in B-Cells; NEMO; anti-IKBKG antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1D4
• Specificity: Recognizes IKBKG.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-IKBKG antibody: Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: IKBKG (NP_003630, 1aa-110aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLE
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(IKBKG monoclonal antibody (M02), clone 1D4 Western Blot analysis of IKBKG expression in HeLa.)

Testing Data

(Detection limit for recombinant GST tagged IKBKG is approximately 3ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to IKBKG on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to IKBKG on HeLa cell. [antibody concentration 10 ug/ml])

Related Product Information for anti-IKBKG antibody

This gene encodes the regulatory subunit of the inhibitor of kappaB kinase (IKK) complex, which activates NF-kappaB resulting in activation of genes involved in inflammation, immunity, cell survival, and other pathways. Mutations in this gene result in incontinentia pigmenti, hypohidrotic ectodermal dysplasia, and several other types of immunodeficiencies. Multiple transcript variants encoding different isoforms have been found for this gene. A pseudogene highly similar to this locus is located in an adjacent region of the X chromosome. [supplied by RefSeq]

Product Categories/Family for anti-IKBKG antibody

Antibodies; Protein Kinase Inhibitors

NCBI and Uniprot Product Information

• NCBI GI #: 4504631
• NCBI GeneID: 8517
• NCBI Accession #: NP_003630
• NCBI GenBank Nucleotide #: NM_003639
• UniProt Accession #: Q9Y6K9
• Molecular Weight: 48kDa
• NCBI Official Full Name: NF-kappa-B essential modulator isoform a
• NCBI Official Synonym Full Names: inhibitor of nuclear factor kappa B kinase regulatory subunit gamma
• NCBI Official Symbol: IKBKG
• NCBI Official Synonym Symbols: IP; IP1; IP2; FIP3; IKKG; IPD2; NEMO; FIP-3; Fip3p; IMD33; AMCBX1; EDAID1; IKKAP1; ZC2HC9; IKK-gamma
• NCBI Protein Information: NF-kappa-B essential modulator
• UniProt Protein Name: NF-kappa-B essential modulator
• UniProt Gene Name: IKBKG
• UniProt Synonym Gene Names: FIP3; NEMO; NEMO; IKKAP1; I-kappa-B kinase subunit gamma; IKK-gamma; IKKG
• UniProt Entry Name: NEMO_HUMAN

NCBI Description

This gene encodes the regulatory subunit of the inhibitor of kappaB kinase (IKK) complex, which activates NF-kappaB resulting in activation of genes involved in inflammation, immunity, cell survival, and other pathways. Mutations in this gene result in incontinentia pigmenti, hypohidrotic ectodermal dysplasia, and several other types of immunodeficiencies. A pseudogene highly similar to this locus is located in an adjacent region of the X chromosome. [provided by RefSeq, Mar 2016]

Uniprot Description

IKKG: a regulatory subunit of the IKK-signalosome complex. Interacts preferentially with IKK-beta but also able to interact with IKK-alpha, IKAP, TAX, RIP and MAP3K14/NIK. Defects are the cause of familial incontinentia pigmenti type II (IP2).

Protein type: Protein kinase, regulatory subunit; Adaptor/scaffold

Chromosomal Location of Human Ortholog: Xq28

Cellular Component: spindle pole; cytoplasm; intracellular; IkappaB kinase complex; nucleus; cytosol; ubiquitin ligase complex

Molecular Function: protein domain specific binding; signal transducer activity; peroxisome proliferator activated receptor binding; protein binding; protein homodimerization activity; protein heterodimerization activity; metal ion binding; ubiquitin protein ligase binding

Biological Process: I-kappaB kinase/NF-kappaB cascade; establishment of vesicle localization; viral reproduction; activation of MAPK activity; apoptosis; stress-activated MAPK cascade; toll-like receptor 3 signaling pathway; T cell receptor signaling pathway; activation of NF-kappaB transcription factor; toll-like receptor 10 signaling pathway; toll-like receptor 5 signaling pathway; B cell homeostasis; positive regulation of interferon type I production; JNK cascade; inflammatory response; toll-like receptor 4 signaling pathway; positive regulation of I-kappaB kinase/NF-kappaB cascade; transcription, DNA-dependent; MyD88-independent toll-like receptor signaling pathway; response to virus; activation of NF-kappaB-inducing kinase; toll-like receptor 2 signaling pathway; MyD88-dependent toll-like receptor signaling pathway; toll-like receptor signaling pathway; innate immune response; positive regulation of transcription from RNA polymerase II promoter; immune response; toll-like receptor 9 signaling pathway; response to DNA damage stimulus

Disease: Invasive Pneumococcal Disease, Recurrent Isolated, 2; Ectodermal Dysplasia, Hypohidrotic, With Immune Deficiency; Immunodeficiency Without Anhidrotic Ectodermal Dysplasia; Immunodeficiency 33; Incontinentia Pigmenti; Ectodermal Dysplasia, Anhidrotic, With Immunodeficiency, Osteopetrosis, And Lymphedema