Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Immunoperoxidase of monoclonal antibody to IKBKE on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3ug/ml])

Mouse anti-Human IKBKE Monoclonal Antibody | anti-IKBKE antibody

IKBKE (Inhibitor of Nuclear Factor kappa-B Kinase Subunit epsilon, I-kappa-B Kinase epsilon, IKK-E, IKK-epsilon, IkBKE, Inducible I kappa-B Kinase, IKK-i, IKKE, IKKI, KIAA0151) (HRP)

Gene Names
IKBKE; IKKE; IKKI; IKK-E; IKK-i
Reactivity
Human
Applications
ELISA, Immunohistochemistry
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
IKBKE; Monoclonal Antibody; IKBKE (Inhibitor of Nuclear Factor kappa-B Kinase Subunit epsilon; I-kappa-B Kinase epsilon; IKK-E; IKK-epsilon; IkBKE; Inducible I kappa-B Kinase; IKK-i; IKKE; IKKI; KIAA0151) (HRP); anti-IKBKE antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1F7
Specificity
Recognizes human IKBKE.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
3240
Applicable Applications for anti-IKBKE antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa541-640 from IKBKE (NP_054721) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QQIQCYLDKMNFIYKQFKKSRMRPGLGYNEEQIHKLDKVNFSHLAKRLLQVFQEECVQKYQASLVTHGKRMRVVHETRNHLRLVGCSVAACNTEAQGVQE
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to IKBKE on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3ug/ml])

Testing Data (Immunoperoxidase of monoclonal antibody to IKBKE on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged IKBKE is 3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged IKBKE is 3ng/ml as a capture antibody.)
Product Categories/Family for anti-IKBKE antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens inhibitor of nuclear factor kappa B kinase subunit epsilon (IKBKE), transcript variant 1, mRNA
NCBI Official Synonym Full Names
inhibitor of nuclear factor kappa B kinase subunit epsilon
NCBI Official Symbol
IKBKE
NCBI Official Synonym Symbols
IKKE; IKKI; IKK-E; IKK-i
NCBI Protein Information
inhibitor of nuclear factor kappa-B kinase subunit epsilon
UniProt Protein Name
Inhibitor of nuclear factor kappa-B kinase subunit epsilon
UniProt Gene Name
IKBKE
UniProt Synonym Gene Names
IKKE; IKKI; KIAA0151; I-kappa-B kinase epsilon; IKK-E; IKK-epsilon; IkBKE; IKK-i
UniProt Entry Name
IKKE_HUMAN

NCBI Description

IKBKE is a noncanonical I-kappa-B (see MIM 164008) kinase (IKK) that is essential for regulating antiviral signaling pathways. IKBKE has also been identified as a breast cancer (MIM 114480) oncogene and is amplified and overexpressed in over 30% of breast carcinomas and breast cancer cell lines (Hutti et al., 2009 [PubMed 19481526]).[supplied by OMIM, Oct 2009]

Uniprot Description

IKKE: a oncogenic kinase of the IKK family. Phosphorylates inhibitors of NF-kappa-B thus leading to the dissociation of the inhibitor/NF-kappa-B complex and ultimately the degradation of the inhibitor. Plays a pivotal role in coordinating the activation of IRF3 and NF-kappaB in the innate immune response. Its redistribution to PML nuclear bodies upon DNA damage is TOPORS-dependent. Is a breast cancer oncogene that exerts its oncogenic properties through cRel.

Protein type: Inhibitor; Kinase, protein; EC 2.7.11.10; Protein kinase, Other; Protein kinase, Ser/Thr (non-receptor); Other group; IKK family

Chromosomal Location of Human Ortholog: 1q32.1

Cellular Component: nucleoplasm; PML body; cytoplasm; mitochondrial membrane; endosome membrane; nucleus; cytosol

Molecular Function: NF-kappaB-inducing kinase activity; protein binding; IkappaB kinase activity; ATP binding

Biological Process: positive regulation of I-kappaB kinase/NF-kappaB cascade; DNA damage response, signal transduction resulting in induction of apoptosis; MyD88-independent toll-like receptor signaling pathway; toll-like receptor signaling pathway; innate immune response; immune response; toll-like receptor 3 signaling pathway; I-kappaB phosphorylation; negative regulation of interferon type I production; toll-like receptor 4 signaling pathway; protein amino acid phosphorylation

Research Articles on IKBKE

Similar Products

Product Notes

The IKBKE ikbke (Catalog #AAA6153045) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The IKBKE (Inhibitor of Nuclear Factor kappa-B Kinase Subunit epsilon, I-kappa-B Kinase epsilon, IKK-E, IKK-epsilon, IkBKE, Inducible I kappa-B Kinase, IKK-i, IKKE, IKKI, KIAA0151) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IKBKE can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin. IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IKBKE ikbke for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IKBKE, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.