Mouse anti-Human IKBKE Monoclonal Antibody | anti-IKBKE antibody

IKBKE (Inhibitor of Nuclear Factor kappa-B Kinase Subunit epsilon, I-kappa-B Kinase epsilon, IKK-E, IKK-epsilon, IkBKE, Inducible I kappa-B Kinase, IKK-i, IKKE, IKKI, KIAA0151) (Biotin)

Cat. Num. AAA6142439

• Gene Names: IKBKE; IKKE; IKKI; IKK-E; IKK-i
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: IKBKE; Monoclonal Antibody; IKBKE (Inhibitor of Nuclear Factor kappa-B Kinase Subunit epsilon; I-kappa-B Kinase epsilon; IKK-E; IKK-epsilon; IkBKE; Inducible I kappa-B Kinase; IKK-i; IKKE; IKKI; KIAA0151) (Biotin); anti-IKBKE antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 1F7
• Specificity: Recognizes human IKBKE.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 3240

• Applicable Applications for anti-IKBKE antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa541-640 from IKBKE (NP_054721) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: QQIQCYLDKMNFIYKQFKKSRMRPGLGYNEEQIHKLDKVNFSHLAKRLLQVFQEECVQKYQASLVTHGKRMRVVHETRNHLRLVGCSVAACNTEAQGVQE
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to IKBKE on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged IKBKE is 3ng/ml as a capture antibody.)

Product Categories/Family for anti-IKBKE antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 1519314353
• NCBI GeneID: 9641
• NCBI Accession #: NM_014002.4
• NCBI GenBank Nucleotide #: NM_014002
• UniProt Accession #: Q14164
• NCBI Official Full Name: Homo sapiens inhibitor of nuclear factor kappa B kinase subunit epsilon (IKBKE), transcript variant 1, mRNA
• NCBI Official Synonym Full Names: inhibitor of nuclear factor kappa B kinase subunit epsilon
• NCBI Official Symbol: IKBKE
• NCBI Official Synonym Symbols: IKKE; IKKI; IKK-E; IKK-i
• NCBI Protein Information: inhibitor of nuclear factor kappa-B kinase subunit epsilon
• UniProt Protein Name: Inhibitor of nuclear factor kappa-B kinase subunit epsilon
• Protein Family: Inhibitor of nuclear factor kappa-B kinase
• UniProt Gene Name: IKBKE
• UniProt Synonym Gene Names: IKKE; IKKI; KIAA0151; I-kappa-B kinase epsilon; IKK-E; IKK-epsilon; IkBKE; IKK-i
• UniProt Entry Name: IKKE_HUMAN

NCBI Description

IKBKE is a noncanonical I-kappa-B (see MIM 164008) kinase (IKK) that is essential for regulating antiviral signaling pathways. IKBKE has also been identified as a breast cancer (MIM 114480) oncogene and is amplified and overexpressed in over 30% of breast carcinomas and breast cancer cell lines (Hutti et al., 2009 [PubMed 19481526]).[supplied by OMIM, Oct 2009]

Uniprot Description

IKKE: a oncogenic kinase of the IKK family. Phosphorylates inhibitors of NF-kappa-B thus leading to the dissociation of the inhibitor/NF-kappa-B complex and ultimately the degradation of the inhibitor. Plays a pivotal role in coordinating the activation of IRF3 and NF-kappaB in the innate immune response. Its redistribution to PML nuclear bodies upon DNA damage is TOPORS-dependent. Is a breast cancer oncogene that exerts its oncogenic properties through cRel.

Protein type: Inhibitor; Kinase, protein; EC 2.7.11.10; Protein kinase, Other; Protein kinase, Ser/Thr (non-receptor); Other group; IKK family

Chromosomal Location of Human Ortholog: 1q32.1

Cellular Component: nucleoplasm; PML body; cytoplasm; mitochondrial membrane; endosome membrane; nucleus; cytosol

Molecular Function: NF-kappaB-inducing kinase activity; protein binding; IkappaB kinase activity; ATP binding

Biological Process: positive regulation of I-kappaB kinase/NF-kappaB cascade; DNA damage response, signal transduction resulting in induction of apoptosis; MyD88-independent toll-like receptor signaling pathway; toll-like receptor signaling pathway; innate immune response; immune response; toll-like receptor 3 signaling pathway; I-kappaB phosphorylation; negative regulation of interferon type I production; toll-like receptor 4 signaling pathway; protein amino acid phosphorylation