Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.72kD).)

Mouse anti-Human IKBKB Monoclonal Antibody | anti-IKBKB antibody

IKBKB (FLJ40509, MGC131801, IKKB, Inhibitor of Nuclear Factor kappa-B Kinase Subunit beta, I-kappa-B Kinase 2, Nuclear Factor NF-kappa-B Inhibitor Kinase beta) (Biotin)

Gene Names
IKBKB; IKK2; IKKB; IMD15; IMD15A; IMD15B; NFKBIKB; IKK-beta
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
IKBKB; Monoclonal Antibody; IKBKB (FLJ40509; MGC131801; IKKB; Inhibitor of Nuclear Factor kappa-B Kinase Subunit beta; I-kappa-B Kinase 2; Nuclear Factor NF-kappa-B Inhibitor Kinase beta) (Biotin); anti-IKBKB antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2C3
Specificity
Recognizes human IKBKB.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
1167
Applicable Applications for anti-IKBKB antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Sandwich ELISA: The detection limit is ~0.1ng/ml as a capture antibody
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa3-120 from human IKBKB (AAH06231) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
WSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCLEIQIMRRLTHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREG
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.72kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.72kD).)

Testing Data

(Detection limit for recombinant GST tagged IKBKB is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged IKBKB is ~0.1ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between TNFRSF1A and IKBKB HeLa cells were stained with TNFRSF1A rabbit purified polyclonal 1:1200 and IKBKB mouse monoclonal antibody 1:50. Signals were detected (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between TNFRSF1A and IKBKB HeLa cells were stained with TNFRSF1A rabbit purified polyclonal 1:1200 and IKBKB mouse monoclonal antibody 1:50. Signals were detected (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Product Categories/Family for anti-IKBKB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta, mRNA
NCBI Official Synonym Full Names
inhibitor of nuclear factor kappa B kinase subunit beta
NCBI Official Symbol
IKBKB
NCBI Official Synonym Symbols
IKK2; IKKB; IMD15; IMD15A; IMD15B; NFKBIKB; IKK-beta
NCBI Protein Information
inhibitor of nuclear factor kappa-B kinase subunit beta

NCBI Description

The protein encoded by this gene phosphorylates the inhibitor in the inhibitor/NF-kappa-B complex, causing dissociation of the inhibitor and activation of NF-kappa-B. The encoded protein itself is found in a complex of proteins. Several transcript variants, some protein-coding and some not, have been found for this gene. [provided by RefSeq, Sep 2011]

Research Articles on IKBKB

Similar Products

Product Notes

The IKBKB (Catalog #AAA6142438) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The IKBKB (FLJ40509, MGC131801, IKKB, Inhibitor of Nuclear Factor kappa-B Kinase Subunit beta, I-kappa-B Kinase 2, Nuclear Factor NF-kappa-B Inhibitor Kinase beta) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IKBKB can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Sandwich ELISA: The detection limit is ~0.1ng/ml as a capture antibody Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IKBKB for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IKBKB, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.