Mouse anti-Human IGFBP1 Monoclonal Antibody | anti-IGFBP1 antibody

IGFBP1 (Insulin-like Growth Factor-binding Protein 1, IBP-1, IGF-binding Protein 1, IGFBP-1, Placental Protein 12, PP12, IBP1) (AP)

Cat. Num. AAA6131827

• Gene Names: IGFBP1; AFBP; IBP1; PP12; IGF-BP25; hIGFBP-1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: IGFBP1; Monoclonal Antibody; IGFBP1 (Insulin-like Growth Factor-binding Protein 1; IBP-1; IGF-binding Protein 1; IGFBP-1; Placental Protein 12; PP12; IBP1) (AP); anti-IGFBP1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2F9
• Specificity: Recognizes human IGFBP1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
• Sequence Length: 259

• Applicable Applications for anti-IGFBP1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa160-259 from human IGFBP1 (NP_000587) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: GSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Related Product Information for anti-IGFBP1 antibody

Human IGF-BP1 is a cysteine-rich secreted protein expressed in liver, decidual, and kidneys and is the most abundant IGF-BP in amniotic fluid. Levels of IGF-BP1 in serum are lowest after food. IGF-BP1 binds both IGF-I and IGF-II with equal affinity. Phosphorylated IGF-BP1 hinders IGF actions, whereas nonphosphorylated IGF-BP1 is stimulatory.

Product Categories/Family for anti-IGFBP1 antibody

Antibodies; Growth Factors; Cytokines

NCBI and Uniprot Product Information

• NCBI GI #: 4504615
• NCBI GeneID: 3484
• NCBI Accession #: NP_000587
• NCBI GenBank Nucleotide #: NM_000596
• UniProt Accession #: P08833
• NCBI Official Full Name: insulin-like growth factor-binding protein 1
• NCBI Official Synonym Full Names: insulin like growth factor binding protein 1
• NCBI Official Symbol: IGFBP1
• NCBI Official Synonym Symbols: AFBP; IBP1; PP12; IGF-BP25; hIGFBP-1
• NCBI Protein Information: insulin-like growth factor-binding protein 1
• UniProt Protein Name: Insulin-like growth factor-binding protein 1
• Protein Family: Insulin-like growth factor-binding protein
• UniProt Gene Name: IGFBP1
• UniProt Synonym Gene Names: IBP1; IBP-1; IGF-binding protein 1; IGFBP-1; PP12
• UniProt Entry Name: IBP1_HUMAN

NCBI Description

This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP N-terminal domain and a thyroglobulin type-I domain. The encoded protein, mainly expressed in the liver, circulates in the plasma and binds both insulin-like growth factors (IGFs) I and II, prolonging their half-lives and altering their interaction with cell surface receptors. This protein is important in cell migration and metabolism. Low levels of this protein may be associated with impaired glucose tolerance, vascular disease and hypertension in human patients. [provided by RefSeq, Aug 2017]

Uniprot Description

IGFBP1: IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Promotes cell migration.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 7p12.3

Cellular Component: extracellular space; extracellular region

Molecular Function: insulin-like growth factor binding; insulin-like growth factor I binding; insulin-like growth factor II binding

Biological Process: cellular protein metabolic process; regulation of insulin-like growth factor receptor signaling pathway; unfolded protein response, activation of signaling protein activity; unfolded protein response; tissue regeneration; insulin receptor signaling pathway; signal transduction; positive regulation of cell growth