Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (85.7kD).)

Mouse anti-Human IFNA2 Monoclonal Antibody | anti-IFNA2 antibody

IFNA2 (Interferon alpha-2, IFN-alpha-2, Interferon alpha-A, LeIF A, MGC125764, MGC125765) (AP)

Gene Names
IFNA2; IFNA; INFA2; IFNA2B; IFN-alphaA
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
IFNA2; Monoclonal Antibody; IFNA2 (Interferon alpha-2; IFN-alpha-2; Interferon alpha-A; LeIF A; MGC125764; MGC125765) (AP); anti-IFNA2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b
Clone Number
1F8
Specificity
Recognizes human IFNA2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-IFNA2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa24-188 from human IFNA2 (NP_000596).
Immunogen Sequence
MDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (85.7kD).)

Western Blot (WB) (Western Blot detection against Immunogen (85.7kD).)

Western Blot (WB)

(Western Blot analysis of IFNA2 expression in transfected 293T cell line by IFNA2 monoclonal antibody. Lane 1: IFNA2 transfected lysate (21.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of IFNA2 expression in transfected 293T cell line by IFNA2 monoclonal antibody. Lane 1: IFNA2 transfected lysate (21.6kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-IFNA2 antibody
The IFNa family has pseudogenes in two families (I and II), one with a mature length of 166aa and one of 172aa. Cells producing IFNa are lymphocytes, monocytes, macrophages and cell lines such as Namalwa and KGI. Bioassays for IFNa include cytopathic effect blocking, by viruses such as VSV, SFV and BMCV, on their target cells. A number of receptors for IFNa are now known and seem to be expressed on most cell types.
Product Categories/Family for anti-IFNA2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19.4kDa (166aa), confirmed by MALDI-TOF.
NCBI Official Full Name
interferon alpha-2
NCBI Official Synonym Full Names
interferon alpha 2
NCBI Official Symbol
IFNA2
NCBI Official Synonym Symbols
IFNA; INFA2; IFNA2B; IFN-alphaA
NCBI Protein Information
interferon alpha-2
UniProt Protein Name
Interferon alpha-2
UniProt Gene Name
IFNA2
UniProt Synonym Gene Names
IFNA2A; IFNA2B; IFNA2C; IFN-alpha-2; LeIF A
UniProt Entry Name
IFNA2_HUMAN

NCBI Description

This gene is a member of the alpha interferon gene cluster on chromosome 9. The encoded protein is a cytokine produced in response to viral infection. Use of the recombinant form of this protein has been shown to be effective in reducing the symptoms and duration of the common cold. [provided by RefSeq, Jun 2011]

Research Articles on IFNA2

Similar Products

Product Notes

The IFNA2 ifna2 (Catalog #AAA6131814) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The IFNA2 (Interferon alpha-2, IFN-alpha-2, Interferon alpha-A, LeIF A, MGC125764, MGC125765) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IFNA2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IFNA2 ifna2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IFNA2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.