Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.52kD).)

Mouse anti-Human IDH2 Monoclonal Antibody | anti-IDH2 antibody

IDH2 (Isocitrate Dehydrogenase [NADP], Mitochondrial, IDH, ICD-M, IDP, NADP(+)-specific ICDH, Oxalosuccinate Decarboxylase) (FITC)

Gene Names
IDH2; IDH; IDP; IDHM; IDPM; ICD-M; D2HGA2; mNADP-IDH
Reactivity
Human
Applications
Western Blot, Immunohistochemistry
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
IDH2; Monoclonal Antibody; IDH2 (Isocitrate Dehydrogenase [NADP]; Mitochondrial; IDH; ICD-M; IDP; NADP(+)-specific ICDH; Oxalosuccinate Decarboxylase) (FITC); anti-IDH2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
5F11
Specificity
Recognizes human IDH2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Concentration
1.2mg/ml (varies by lot)
Sequence
HYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIKSNLDRALGR
Applicable Applications for anti-IDH2 antibody
FLISA, Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
Immunohistochemistry: Formalin fixed and paraffin embedded tissues Optimal dilutions to be determined by the researcher. Other applications not tested.

Note: Applications are based on unconjugated antibody.
Grade
Affinity Purified
Immunogen
Partial recombinant corresponding to aa354-451 from human IDH2 (NP_002159) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.52kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.52kD).)

Western Blot (WB)

(Western Blot analysis of IDH2 expression in transfected 293T cell line by IDH2 monoclonal antibody. Lane 1: IDH2 transfected lysate (50.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of IDH2 expression in transfected 293T cell line by IDH2 monoclonal antibody. Lane 1: IDH2 transfected lysate (50.9kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to IDH2 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to IDH2 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged IDH2 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged IDH2 is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-IDH2 antibody
Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the mitochondria. It plays a role in intermediary metabolism and energy production. This protein may tightly associate or interact with the pyruvate dehydrogenase complex. [provided by RefSeq]
Product Categories/Family for anti-IDH2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
isocitrate dehydrogenase
NCBI Official Synonym Full Names
isocitrate dehydrogenase 2 (NADP+), mitochondrial
NCBI Official Symbol
IDH2
NCBI Official Synonym Symbols
IDH; IDP; IDHM; IDPM; ICD-M; D2HGA2; mNADP-IDH
NCBI Protein Information
isocitrate dehydrogenase [NADP], mitochondrial; isocitrate dehydrogenase [NADP], mitochondrial; NADP(+)-specific ICDH; oxalosuccinate decarboxylase
UniProt Protein Name
Isocitrate dehydrogenase [NADP], mitochondrial
Protein Family
UniProt Gene Name
IDH2
UniProt Synonym Gene Names
IDH
UniProt Entry Name
IDHP_HUMAN

NCBI Description

Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the mitochondria. It plays a role in intermediary metabolism and energy production. This protein may tightly associate or interact with the pyruvate dehydrogenase complex. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2014]

Research Articles on IDH2

Similar Products

Product Notes

The IDH2 idh2 (Catalog #AAA6147706) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The IDH2 (Isocitrate Dehydrogenase [NADP], Mitochondrial, IDH, ICD-M, IDP, NADP(+)-specific ICDH, Oxalosuccinate Decarboxylase) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IDH2 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB), Immunohistochemistry (IHC). Immunohistochemistry: Formalin fixed and paraffin embedded tissues Optimal dilutions to be determined by the researcher. Other applications not tested. Note: Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IDH2 idh2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: HYREHQKGRP TSTNPIASIF AWTRGLEHRG KLDGNQDLIR FAQMLEKVCV ETVESGAMTK DLAGCIHGLS NVKLNEHFLN TTDFLDTIKS NLDRALGR. It is sometimes possible for the material contained within the vial of "IDH2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.