Mouse ID2 Monoclonal Antibody | anti-ID2 antibody

ID2 (Inhibitor of DNA Binding 2, Dominant Negative Helix-loop-Helix Protein, GIG8, ID2A, ID2H, MGC26389, bHLHb26) (AP)

Cat. Num. AAA6162965

• Gene Names: ID2; GIG8; ID2A; ID2H; bHLHb26
• Applications: Western Blot
• Purity: Purified
• Synonyms: ID2; Monoclonal Antibody; ID2 (Inhibitor of DNA Binding 2; Dominant Negative Helix-loop-Helix Protein; GIG8; ID2A; ID2H; MGC26389; bHLHb26) (AP); Inhibitor of DNA Binding 2; bHLHb26; anti-ID2 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2C11
• Specificity: Recognizes ID2.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
• Sequence Length: 134

• Applicable Applications for anti-ID2 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: ID2 (AAH30639, 1aa-134aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(ID2 monoclonal antibody (M04), clone 2C11 Western Blot analysis of ID2 expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of ID2 expression in transfected 293T cell line by ID2 monoclonal antibody (M04), clone 2C11.Lane 1: ID2 transfected lysate(14.9 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB)

(ID2 monoclonal antibody (M04), clone 2C11. Western Blot analysis of ID2 expression in HepG2.)

Related Product Information for anti-ID2 antibody

The protein encoded by this gene belongs to the inhibitor of DNA binding (ID) family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the ID family inhibit the functions of basic helix-loop-helix transcription factors in a dominant-negative manner by suppressing their heterodimerization partners through the HLH domains. This protein may play a role in negatively regulating cell differentiation. A pseudogene has been identified for this gene. [provided by RefSeq]

Product Categories/Family for anti-ID2 antibody

Antibodies; Binding Proteins

References

1. The Transcriptional Repressor ID2 Can Interact with the Canonical Clock Components CLOCK and BMAL1 and Mediate Inhibitory Effects on mPer1 Expression.Ward SM, Fernando SJ, Hou TY, Duffield GE.J Biol Chem. 2010 Dec 10;285(50):38987-9000. Epub 2010 Sep 22.

NCBI and Uniprot Product Information

• NCBI GI #: 21040395
• NCBI GeneID: 3398
• NCBI Official Full Name: Inhibitor of DNA binding 2, dominant negative helix-loop-helix protein
• NCBI Official Synonym Full Names: inhibitor of DNA binding 2
• NCBI Official Symbol: ID2
• NCBI Official Synonym Symbols: GIG8; ID2A; ID2H; bHLHb26
• NCBI Protein Information: DNA-binding protein inhibitor ID-2
• Protein Family: DNA-binding protein inhibitor

NCBI Description

The protein encoded by this gene belongs to the inhibitor of DNA binding family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the inhibitor of DNA binding family inhibit the functions of basic helix-loop-helix transcription factors in a dominant-negative manner by suppressing their heterodimerization partners through the HLH domains. This protein may play a role in negatively regulating cell differentiation. A pseudogene of this gene is located on chromosome 3. [provided by RefSeq, Aug 2011]