Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged ID1 is approximately 1ng/ml as a capture antibody.)

Mouse ID1 Monoclonal Antibody | anti-ID1 antibody

ID1 (Inhibitor of DNA Binding 1, Dominant Negative Helix-loop-Helix Protein, ID, bHLHb24) (PE)

Gene Names
ID1; ID; bHLHb24
Applications
Western Blot
Purity
Purified
Synonyms
ID1; Monoclonal Antibody; ID1 (Inhibitor of DNA Binding 1; Dominant Negative Helix-loop-Helix Protein; ID; bHLHb24) (PE); Inhibitor of DNA Binding 1; bHLHb24; anti-ID1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3F8
Specificity
Recognizes ID1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-ID1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
ID1 (NP_002156, 47aa-155aa) full length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR*
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged ID1 is approximately 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ID1 is approximately 1ng/ml as a capture antibody.)
Related Product Information for anti-ID1 antibody
The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with members of the basic HLH family of transcription factors. The encoded protein has no DNA binding activity and therefore can inhibit the DNA binding and transcriptional activation ability of basic HLH proteins with which it interacts. This protein may play a role in cell growth, senescence, and differentiation. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Product Categories/Family for anti-ID1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
18.5 kDa (178aa) confirmed by MALDI-TOF
NCBI Official Full Name
DNA-binding protein inhibitor ID-1 isoform a
NCBI Official Synonym Full Names
inhibitor of DNA binding 1, HLH protein
NCBI Official Symbol
ID1
NCBI Official Synonym Symbols
ID; bHLHb24
NCBI Protein Information
DNA-binding protein inhibitor ID-1
UniProt Protein Name
DNA-binding protein inhibitor ID-1
UniProt Gene Name
ID1
UniProt Synonym Gene Names
BHLHB24; ID; bHLHb24
UniProt Entry Name
ID1_HUMAN

NCBI Description

The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with members of the basic HLH family of transcription factors. The encoded protein has no DNA binding activity and therefore can inhibit the DNA binding and transcriptional activation ability of basic HLH proteins with which it interacts. This protein may play a role in cell growth, senescence, and differentiation. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

ID1: ID (inhibitor of DNA binding) HLH proteins lack a basic DNA-binding domain but are able to form heterodimers with other HLH proteins, thereby inhibiting DNA binding. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription, coactivator/corepressor; DNA-binding

Chromosomal Location of Human Ortholog: 20q11

Cellular Component: nucleoplasm; Golgi apparatus; nucleus

Molecular Function: protein dimerization activity; protein binding; transcription factor activity

Biological Process: circadian rhythm; collagen metabolic process; blood vessel endothelial cell migration; transcription, DNA-dependent; protein destabilization; heart development; negative regulation of transcription factor activity; negative regulation of transcription from RNA polymerase II promoter; regulation of angiogenesis; negative regulation of DNA binding; BMP signaling pathway; response to antibiotic; regulation of MAPKKK cascade; transforming growth factor beta receptor signaling pathway; blood vessel morphogenesis; negative regulation of osteoblast differentiation; endothelial cell morphogenesis; angiogenesis; negative regulation of transcription, DNA-dependent; negative regulation of apoptosis

Research Articles on ID1

Similar Products

Product Notes

The ID1 id1 (Catalog #AAA6185461) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's ID1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ID1 id1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ID1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.