Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human HYOU1 Monoclonal Antibody | anti-HYOU1 antibody

HYOU1 (GRP170, ORP150, Hypoxia Up-regulated Protein 1, 150kD Oxygen-regulated Protein, 170kD Glucose-regulated Protein) APC

Gene Names
HYOU1; IMD59; Grp170; HSP12A; ORP150; GRP-170; ORP-150
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HYOU1; Monoclonal Antibody; HYOU1 (GRP170; ORP150; Hypoxia Up-regulated Protein 1; 150kD Oxygen-regulated Protein; 170kD Glucose-regulated Protein) APC; anti-HYOU1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
6F7
Specificity
Recognizes human HYOU1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-HYOU1 antibody
ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa901-999 from human HYOU1 (NP_006380) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EVQYLLNKAKFTKPRPRPKDKNGTRAEPPLNASASDQGEKVIPPAGQTEDAEPISEPEKVETGSEPGDTEPLELGGPGAEPEQKEQSTGQKRPLKNDEL
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(Western Blot analysis of HYOU1 expression in MCF-7 usingMBS6006063.)

Western Blot (WB) (Western Blot analysis of HYOU1 expression in MCF-7 usingMBS6006063.)

Immunohistochemistry (IHC)

(Immunoperoxidase of MBS6006063 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 1ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of MBS6006063 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 1ug/ml])

Testing Data

(Detection limit for recombinant GST tagged HYOU1 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged HYOU1 is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-HYOU1 antibody
HYOU1 belongs to the heat shock protein 70 family. The protein is thought to play an important role in protein folding and secretion in the ER. Since suppression of the protein is associated with accelerated apoptosis, it is also suggested to have an important cytoprotective role in hypoxia-induced cellular perturbation. This protein has been shown to be up-regulated in tumors, especially in breast tumors, and thus it is associated with tumor invasiveness. This signal peptide-lacking protein, which is only 3aa shorter than the mature protein in the ER, is thought to have a housekeeping function in the cytosol. In rat, this protein localizes to both the ER by a carboxy-terminal peptide sequence and to mitochondria by an amino-terminal targeting signal.
Product Categories/Family for anti-HYOU1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
108kDa
NCBI Official Full Name
hypoxia up-regulated protein 1
NCBI Official Synonym Full Names
hypoxia up-regulated 1
NCBI Official Symbol
HYOU1
NCBI Official Synonym Symbols
IMD59; Grp170; HSP12A; ORP150; GRP-170; ORP-150
NCBI Protein Information
hypoxia up-regulated protein 1
UniProt Protein Name
Hypoxia up-regulated protein 1
UniProt Gene Name
HYOU1
UniProt Synonym Gene Names
GRP170; ORP150; ORP-150; GRP-170
UniProt Entry Name
HYOU1_HUMAN

NCBI Description

The protein encoded by this gene belongs to the heat shock protein 70 family. This gene uses alternative transcription start sites. A cis-acting segment found in the 5' UTR is involved in stress-dependent induction, resulting in the accumulation of this protein in the endoplasmic reticulum (ER) under hypoxic conditions. The protein encoded by this gene is thought to play an important role in protein folding and secretion in the ER. Since suppression of the protein is associated with accelerated apoptosis, it is also suggested to have an important cytoprotective role in hypoxia-induced cellular perturbation. This protein has been shown to be up-regulated in tumors, especially in breast tumors, and thus it is associated with tumor invasiveness. This gene also has an alternative translation initiation site, resulting in a protein that lacks the N-terminal signal peptide. This signal peptide-lacking protein, which is only 3 amino acids shorter than the mature protein in the ER, is thought to have a housekeeping function in the cytosol. In rat, this protein localizes to both the ER by a carboxy-terminal peptide sequence and to mitochondria by an amino-terminal targeting signal. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2014]

Uniprot Description

HYOU1: Has a pivotal role in cytoprotective cellular mechanisms triggered by oxygen deprivation. May play a role as a molecular chaperone and participate in protein folding. Belongs to the heat shock protein 70 family.

Protein type: Heat shock protein; Chaperone

Chromosomal Location of Human Ortholog: 11q23.1-q23.3

Cellular Component: smooth endoplasmic reticulum; focal adhesion; membrane; endoplasmic reticulum; endoplasmic reticulum lumen; extracellular region

Molecular Function: chaperone binding; ATP binding

Biological Process: receptor-mediated endocytosis; cellular protein metabolic process; unfolded protein response, activation of signaling protein activity; unfolded protein response

Research Articles on HYOU1

Similar Products

Product Notes

The HYOU1 hyou1 (Catalog #AAA6137091) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HYOU1 (GRP170, ORP150, Hypoxia Up-regulated Protein 1, 150kD Oxygen-regulated Protein, 170kD Glucose-regulated Protein) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HYOU1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HYOU1 hyou1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HYOU1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.