Testing Data
(Detection limit for recombinant GST tagged HUNK is approximately 1ng/ml as a capture antibody.)
Mouse HUNK Monoclonal Antibody | anti-HUNK antibody
HUNK (hormonally up-Regulated Neu-Associated Kinase) (AP)
Applications
Western Blot
Purity
Purified
Synonyms
HUNK; Monoclonal Antibody; HUNK (hormonally up-Regulated Neu-Associated Kinase) (AP); hormonally up-Regulated Neu-Associated Kinase; anti-HUNK antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2G6
Specificity
Recognizes HUNK.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-HUNK antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
HUNK (NP_055401, 615aa-714aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LHPTLVSFAHEDKNSPPKEEGLCCPPPVPSNGPMQPLGSPNCVKSRGRFPMMGIGQMLRKRHQSLQPSADRPLEASLPPLQPLAPVNLAFDMADGVKTQC
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged HUNK is approximately 1ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged HUNK is approximately 1ng/ml as a capture antibody.)
Related Product Information for anti-HUNK antibody
Mouse monoclonal antibody raised against a partial recombinant HUNK.
Product Categories/Family for anti-HUNK antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
79,686 Da
NCBI Official Full Name
hormonally up-regulated neu tumor-associated kinase
NCBI Official Synonym Full Names
hormonally up-regulated Neu-associated kinase
NCBI Official Symbol
HUNK
NCBI Protein Information
hormonally up-regulated neu tumor-associated kinase; B19; hormonally upregulated Neu-associated kinase; hormonally upregulated neu tumor-associated kinase; serine/threonine protein kinase MAK-V; serine/threonine-protein kinase MAK-V
UniProt Protein Name
Hormonally up-regulated neu tumor-associated kinase
Protein Family
UniProt Gene Name
HUNK
UniProt Synonym Gene Names
MAKV
UniProt Entry Name
HUNK_HUMAN
Uniprot Description
HUNK: a protein kinase of the CAMKL family. Is developmentally regulated in a tissue-specific fashion. May contribute to changes in the mammary gland that occur during pregnancy in response to ovarian hormones. The active enzyme is localized in the nucleocytoplasm and the centrosome.
Protein type: Protein kinase, CAMK; Protein kinase, Ser/Thr (non-receptor); Kinase, protein; EC 2.7.11.1; CAMK group; CAMKL family; HUNK subfamily
Chromosomal Location of Human Ortholog: 21q22.1
Molecular Function: protein serine/threonine kinase activity; ATP binding
Biological Process: multicellular organismal development; signal transduction; protein amino acid phosphorylation
Similar Products
Product Notes
The HUNK hunk (Catalog #AAA6162860) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's HUNK can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HUNK hunk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HUNK, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
