Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged HTR5A is approximately 0.03ng/ml as a capture antibody.)

Mouse HTR5A Monoclonal Antibody | anti-HTR5A antibody

HTR5A (5-hydroxytryptamine (Serotonin) Receptor 5A, 5-HT5A, MGC138226) (PE)

Gene Names
HTR5A; 5-HT5A
Applications
Western Blot
Purity
Purified
Synonyms
HTR5A; Monoclonal Antibody; HTR5A (5-hydroxytryptamine (Serotonin) Receptor 5A; 5-HT5A; MGC138226) (PE); 5-hydroxytryptamine (Serotonin) Receptor 5A; MGC138226; anti-HTR5A antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3D1
Specificity
Recognizes HTR5A.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-HTR5A antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
HTR5A (NP_076917, 223aa-282aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
IYKAAKFRVGSRKTNSVSPISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKEQR
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged HTR5A is approximately 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged HTR5A is approximately 0.03ng/ml as a capture antibody.)

Western Blot (WB)

(HTR5A monoclonal antibody (M02), clone 3D1. Western Blot analysis of HTR5A expression in PC-12.)

Western Blot (WB) (HTR5A monoclonal antibody (M02), clone 3D1. Western Blot analysis of HTR5A expression in PC-12.)
Related Product Information for anti-HTR5A antibody
The neurotransmitter serotonin (5-hydroxytryptamine, 5-HT) has been implicated in a wide range of psychiatric conditions and also has vasoconstrictive and vasodilatory effects. The gene described in this record is a member of 5-hydroxytryptamine (serotonin) receptor family and encodes a multi-pass membrane protein that functions as a receptor for 5-hydroxytryptamine and couples to G-proteins. This protein has been shown to function in part through the regulation of intracellular Ca2+ mobilization. [provided by RefSeq]
Product Categories/Family for anti-HTR5A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40,255 Da
NCBI Official Full Name
5-hydroxytryptamine receptor 5A
NCBI Official Synonym Full Names
5-hydroxytryptamine (serotonin) receptor 5A, G protein-coupled
NCBI Official Symbol
HTR5A
NCBI Official Synonym Symbols
5-HT5A
NCBI Protein Information
5-hydroxytryptamine receptor 5A
UniProt Protein Name
5-hydroxytryptamine receptor 5A
UniProt Gene Name
HTR5A
UniProt Synonym Gene Names
5-HT-5; 5-HT-5A; 5-HT5A
UniProt Entry Name
5HT5A_HUMAN

NCBI Description

The neurotransmitter serotonin (5-hydroxytryptamine, 5-HT) has been implicated in a wide range of psychiatric conditions and also has vasoconstrictive and vasodilatory effects. The gene described in this record is a member of 5-hydroxytryptamine (serotonin) receptor family and encodes a multi-pass membrane protein that functions as a receptor for 5-hydroxytryptamine and couples to G-proteins. This protein has been shown to function in part through the regulation of intracellular Ca2+ mobilization. [provided by RefSeq, Jul 2008]

Uniprot Description

5-HT(5A): This is one of the several different receptors for 5- hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins. Belongs to the G-protein coupled receptor 1 family.

Protein type: GPCR, family 1; Receptor, GPCR; Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 7q36.1

Cellular Component: Golgi apparatus; rough endoplasmic reticulum; integral to plasma membrane; dendrite; plasma membrane; perikaryon

Molecular Function: serotonin receptor activity

Biological Process: G-protein signaling, coupled to cyclic nucleotide second messenger; G-protein coupled receptor protein signaling pathway; cAMP-mediated signaling; hippocampus development; serotonin receptor signaling pathway; response to estradiol stimulus

Research Articles on HTR5A

Similar Products

Product Notes

The HTR5A htr5a (Catalog #AAA6186078) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's HTR5A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HTR5A htr5a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HTR5A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.