Mouse anti-Human HTR1E Monoclonal Antibody | anti-HTR1E antibody

HTR1E (5-hydroxytryptamine Receptor 1E, 5-HT-1E, 5-HT1E, S31, Serotonin Receptor 1E) (MaxLight 750)

Cat. Num. AAA6233344

• Gene Names: HTR1E; 5-HT1E
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: HTR1E; Monoclonal Antibody; HTR1E (5-hydroxytryptamine Receptor 1E; 5-HT-1E; 5-HT1E; S31; Serotonin Receptor 1E) (MaxLight 750); anti-HTR1E antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2E9
• Specificity: Recognizes human HTR1E.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.

• Applicable Applications for anti-HTR1E antibody: FLISA, Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa206-276 from human HTR1E (NP_000856.1) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: YHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKLTQTFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPG
• Conjugate: MaxLight750
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Related Product Information for anti-HTR1E antibody

5HT1E, a Serotonin Receptor, is not well studied. It is classified as an 5-HT1-like receptor because of its ligand-binding and effector-coupling characteristics. The human 5-HT1E receptor has been studied in an African green monkey kidney cell line, in which it modulated cAMP levels upon binding serotonin. Lack of structural variants in the human gene indicate a highly conserved protein. The 5-HT1E receptor has been reported to be expressed in human cortex, caudate, putamen, and amygdala, as well as in dorsal root ganglia and in coronary artery. ESTs have been isolated from human brain cancer libraries.

Product Categories/Family for anti-HTR1E antibody

Antibodies; Serotonin Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 4504537
• NCBI GeneID: 3354
• NCBI Accession #: NP_000856.1
• NCBI GenBank Nucleotide #: NM_000865
• UniProt Accession #: P28566; Q9P1Y1; E1P503
• Molecular Weight: 41,682 Da
• NCBI Official Full Name: 5-hydroxytryptamine receptor 1E
• NCBI Official Synonym Full Names: 5-hydroxytryptamine (serotonin) receptor 1E, G protein-coupled
• NCBI Official Symbol: HTR1E
• NCBI Official Synonym Symbols: 5-HT1E
• NCBI Protein Information: 5-hydroxytryptamine receptor 1E; S31; 5-HT-1E; serotonin receptor 1E
• UniProt Protein Name: 5-hydroxytryptamine receptor 1E
• Protein Family: 5-hydroxytryptamine receptor
• UniProt Gene Name: HTR1E
• UniProt Synonym Gene Names: 5-HT-1E; 5-HT1E
• UniProt Entry Name: 5HT1E_HUMAN

Uniprot Description

5-HT(1E): This is one of the several different receptors for 5- hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that inhibit adenylate cyclase activity. Belongs to the G-protein coupled receptor 1 family.

Protein type: Receptor, GPCR; Membrane protein, integral; GPCR, family 1; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 6q14-q15

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: G-protein coupled receptor activity; serotonin binding; serotonin receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway; synaptic transmission; G-protein signaling, coupled to cyclic nucleotide second messenger; negative regulation of cAMP metabolic process; G-protein signaling, adenylate cyclase inhibiting pathway; serotonin receptor signaling pathway