Mouse HSPB8 Monoclonal Antibody | anti-HSPB8 antibody

HSPB8 (Heat Shock 22kD Protein 8, CMT2L, DHMN2, E2IG1, H11, HMN2, HMN2A, HSP22) (AP)

Cat. Num. AAA6163290

• Gene Names: HSPB8; H11; HMN2; CMT2L; DHMN2; E2IG1; HMN2A; HSP22
• Applications: Western Blot
• Purity: Purified
• Synonyms: HSPB8; Monoclonal Antibody; HSPB8 (Heat Shock 22kD Protein 8; CMT2L; DHMN2; E2IG1; H11; HMN2; HMN2A; HSP22) (AP); Heat Shock 22kD Protein 8; HSP22; anti-HSPB8 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 5C3
• Specificity: Recognizes HSPB8.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-HSPB8 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: HSPB8 (NP_055180, 97aa-196aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: KVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of HSPB8 expression in transfected 293T cell line by HSPB8 monoclonal antibody (M03), clone 5C3.Lane 1: HSPB8 transfected lysate(35.446 KDa).Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged HSPB8 is approximately 1ng/ml as a capture antibody.)

Related Product Information for anti-HSPB8 antibody

The protein encoded by this gene belongs to the superfamily of small heat-shock proteins containing a conservative alpha-crystallin domain at the C-terminal part of the molecule. The expression of this gene in induced by estrogen in estrogen receptor-positive breast cancer cells, and this protein also functions as a chaperone in association with Bag3, a stimulator of macroautophagy. Thus, this gene appears to be involved in regulation of cell proliferation, apoptosis, and carcinogenesis, and mutations in this gene have been associated with different neuromuscular diseases, including Charcot-Marie-Tooth disease. [provided by RefSeq]

Product Categories/Family for anti-HSPB8 antibody

Antibodies; Heat Shock Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 7657146
• NCBI GeneID: 26353
• NCBI Accession #: NP_055180
• NCBI GenBank Nucleotide #: NM_014365.2
• UniProt Accession #: Q9UJY1; Q6FIH3; Q9UKS3; B2R6A6
• Molecular Weight: 23.7 kDa (216aa), confirmed by MALDI-TOF.
• NCBI Official Full Name: heat shock protein beta-8
• NCBI Official Synonym Full Names: heat shock protein family B (small) member 8
• NCBI Official Symbol: HSPB8
• NCBI Official Synonym Symbols: H11; HMN2; CMT2L; DHMN2; E2IG1; HMN2A; HSP22
• NCBI Protein Information: heat shock protein beta-8
• UniProt Protein Name: Heat shock protein beta-8
• Protein Family: Heat shock protein
• UniProt Gene Name: HSPB8
• UniProt Synonym Gene Names: CRYAC; E2IG1; HSP22; HspB8
• UniProt Entry Name: HSPB8_HUMAN

NCBI Description

The protein encoded by this gene belongs to the superfamily of small heat-shock proteins containing a conservative alpha-crystallin domain at the C-terminal part of the molecule. The expression of this gene in induced by estrogen in estrogen receptor-positive breast cancer cells, and this protein also functions as a chaperone in association with Bag3, a stimulator of macroautophagy. Thus, this gene appears to be involved in regulation of cell proliferation, apoptosis, and carcinogenesis, and mutations in this gene have been associated with different neuromuscular diseases, including Charcot-Marie-Tooth disease. [provided by RefSeq, Jul 2008]

Uniprot Description

HSPB8: Displays temperature-dependent chaperone activity. Monomer. Interacts with HSPB1. Interacts with DNAJB6. By 17-beta-estradiol. Predominantly expressed in skeletal muscle and heart. Belongs to the small heat shock protein (HSP20) family.

Protein type: Heat shock protein

Chromosomal Location of Human Ortholog: 12q24.23

Cellular Component: nucleoplasm; Golgi apparatus; cytoplasm; intracellular; nucleus

Molecular Function: identical protein binding; protein binding; protein kinase activity

Disease: Charcot-marie-tooth Disease, Axonal, Type 2l; Neuronopathy, Distal Hereditary Motor, Type Iia