Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (HSPB8 monoclonal antibody (M12), clone 3C5. Western Blot analysis of HSPB8 expression in HeLa.)

Mouse HSPB8 Monoclonal Antibody | anti-HSPB8 antibody

HSPB8 (Heat Shock 22kD Protein 8, CMT2L, DHMN2, E2IG1, H11, HMN2, HMN2A, HSP22) (FITC)

Applications
Western Blot
Purity
Purified
Synonyms
HSPB8; Monoclonal Antibody; HSPB8 (Heat Shock 22kD Protein 8; CMT2L; DHMN2; E2IG1; H11; HMN2; HMN2A; HSP22) (FITC); Heat Shock 22kD Protein 8; HSP22; anti-HSPB8 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3C5
Specificity
Recognizes HSPB8.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
196
Applicable Applications for anti-HSPB8 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
HSPB8 (AAH02673.1, 1aa-196aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVPRGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(HSPB8 monoclonal antibody (M12), clone 3C5. Western Blot analysis of HSPB8 expression in HeLa.)

Western Blot (WB) (HSPB8 monoclonal antibody (M12), clone 3C5. Western Blot analysis of HSPB8 expression in HeLa.)

Testing Data

(Detection limit for recombinant GST tagged HSPB8 is 0.03 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged HSPB8 is 0.03 ng/ml as a capture antibody.)
Related Product Information for anti-HSPB8 antibody
The protein encoded by this gene belongs to the superfamily of small heat-shock proteins containing a conservative alpha-crystallin domain at the C-terminal part of the molecule. The expression of this gene in induced by estrogen in estrogen receptor-positive breast cancer cells, and this protein also functions as a chaperone in association with Bag3, a stimulator of macroautophagy. Thus, this gene appears to be involved in regulation of cell proliferation, apoptosis, and carcinogenesis, and mutations in this gene have been associated with different neuromuscular diseases, including Charcot-Marie-Tooth disease. [provided by RefSeq]
Product Categories/Family for anti-HSPB8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI Official Full Name
Heat shock 22kDa protein 8
Protein Family

Similar Products

Product Notes

The HSPB8 (Catalog #AAA6178180) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's HSPB8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HSPB8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HSPB8, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.