Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.68kD).)

Mouse anti-Human HSD17B7 Monoclonal Antibody | anti-HSD17B7 antibody

HSD17B7 (3-keto-steroid Reductase, 17-beta-hydroxysteroid Dehydrogenase 7, 17-beta-HSD 7, Estradiol 17-beta-dehydrogenase 7, UNQ2563/PRO6243, MGC12523, MGC75018, PRAP, SDR37C1) (AP)

Gene Names
HSD17B7; PRAP; SDR37C1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HSD17B7; Monoclonal Antibody; HSD17B7 (3-keto-steroid Reductase; 17-beta-hydroxysteroid Dehydrogenase 7; 17-beta-HSD 7; Estradiol 17-beta-dehydrogenase 7; UNQ2563/PRO6243; MGC12523; MGC75018; PRAP; SDR37C1) (AP); anti-HSD17B7 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1G10
Specificity
Recognizes human HSD17B7.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-HSD17B7 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa255-342 from human HSD17B7 (NP_057455) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NAFTLTPYNGTEALVWLFHQKPESLNPLIKYLSATTGFGRNYIMTQKMDLDEDTAEKFYQKLLELEKHIRVTIQKTDNQARLSGSCL
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.68kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.68kD).)

Testing Data

(Detection limit for recombinant GST tagged HSD17B7 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged HSD17B7 is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-HSD17B7 antibody
Responsible for the reduction of the keto group on the C-3 of sterols.
Product Categories/Family for anti-HSD17B7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34,476 Da
NCBI Official Full Name
3-keto-steroid reductase
NCBI Official Synonym Full Names
hydroxysteroid (17-beta) dehydrogenase 7
NCBI Official Symbol
HSD17B7
NCBI Official Synonym Symbols
PRAP; SDR37C1
NCBI Protein Information
3-keto-steroid reductase; 17-beta-HSD 7; estradiol 17-beta-dehydrogenase 7; 17beta hydroxysteroid dehydrogenase; 17-beta-hydroxysteroid dehydrogenase 7; 17 beta-hydroxysteroid dehydrogenase type VII; short chain dehydrogenase/reductase family 37C, member
UniProt Protein Name
3-keto-steroid reductase
UniProt Gene Name
HSD17B7
UniProt Synonym Gene Names
17-beta-HSD 7
UniProt Entry Name
DHB7_HUMAN

NCBI Description

HSD17B7 encodes an enzyme that functions both as a 17-beta-hydroxysteroid dehydrogenase (EC 1.1.1.62) in the biosynthesis of sex steroids and as a 3-ketosteroid reductase (EC 1.1.1.270) in the biosynthesis of cholesterol (Marijanovic et al., 2003 [PubMed 12829805]).[supplied by OMIM, May 2010]

Uniprot Description

Function: Responsible for the reduction of the keto group on the C-3 of sterols. Ref.11

Catalytic activity: A 3-beta-hydroxysteroid + NADP+ = a 3-oxosteroid + NADPH.17-beta-estradiol + NAD(P)+ = estrone + NAD(P)H.

Pathway: Steroid biosynthesis; estrogen biosynthesis.Steroid biosynthesis; zymosterol biosynthesis; zymosterol from lanosterol: step 5/6.

Subcellular location: Cell membrane; Single-pass membrane protein.

Tissue specificity: Highly expressed in adrenal gland, liver, lung and thymus. Expressed in breast, ovaries, pituitary gland, pregnant uterus, prostate, kidney, lymph node, small intestine, spinal cord and trachea. Weakly expressed in all other tissues tested. Isoform 3 is expressed in eye ciliary epithelial cells and neuroendocrine cells.

Post-translational modification: Phosphorylated.

Sequence similarities: Belongs to the short-chain dehydrogenases/reductases (SDR) family. ERG27 subfamily.

Research Articles on HSD17B7

Similar Products

Product Notes

The HSD17B7 hsd17b7 (Catalog #AAA6131755) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HSD17B7 (3-keto-steroid Reductase, 17-beta-hydroxysteroid Dehydrogenase 7, 17-beta-HSD 7, Estradiol 17-beta-dehydrogenase 7, UNQ2563/PRO6243, MGC12523, MGC75018, PRAP, SDR37C1) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HSD17B7 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HSD17B7 hsd17b7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HSD17B7, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.