Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.41kD).)

Mouse anti-Human HSD17B1 Monoclonal Antibody | anti-HSD17B1 antibody

HSD17B1 (E17KSR, EDH17B1, EDH17B2, EDHB17, Estradiol 17-beta-dehydrogenase 1, 17-beta-HSD 1, 20 alpha-hydroxysteroid Dehydrogenase, 20-alpha-HSD, E2DH, Placental 17-beta-hydroxysteroid Dehydrogenase, MGC138140) (PE)

Gene Names
HSD17B1; E2DH; HSD17; EDHB17; EDH17B2; SDR28C1; 17-beta-HSD; 20-alpha-HSD
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HSD17B1; Monoclonal Antibody; HSD17B1 (E17KSR; EDH17B1; EDH17B2; EDHB17; Estradiol 17-beta-dehydrogenase 1; 17-beta-HSD 1; 20 alpha-hydroxysteroid Dehydrogenase; 20-alpha-HSD; E2DH; Placental 17-beta-hydroxysteroid Dehydrogenase; MGC138140) (PE); anti-HSD17B1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2E5
Specificity
Recognizes human HSD17B1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-HSD17B1 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa189-285 from human HSD17B1 (NP_000404) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VHTAFMEKVLGSPEEVLDRTDIHTFHRFYQYLAHSKQVFREAAQNPEEVAEVFLTALRAPKPTLRYFTTERFLPLLRMRLDDPSGSNYVTAMHREVF
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.41kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.41kD).)

Western Blot (WB)

(HSD17B1 monoclonal antibody Western Blot analysis of HSD17B1 expression in Jurkat)

Western Blot (WB) (HSD17B1 monoclonal antibody Western Blot analysis of HSD17B1 expression in Jurkat)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to HSD17B1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to HSD17B1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged HSD17B1 is 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged HSD17B1 is 0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-HSD17B1 antibody
References
1. The role of estrogen-metabolizing enzymes and estrogen receptors in human epidermis. Inoue T, Miki Y, Abe K, Hatori M, Hosaka M, Kariya Y, Kakuo S, Fujimura T, Hachiya A, Aiba S, Sasano H.Mol Cell Endocrinol. 2011 Jun 29. 2. Increased estrogen sulfatase (STS) and 17beta-hydroxysteroid dehydrogenase type 1(17beta-HSD1) following neoadjuvant aromatase inhibitor therapy in breast cancer patients. Chanplakorn N, Chanplakorn P, Suzuki T, Ono K, Chan MS, Miki Y, Saji S, Ueno T, Toi M, Sasano H.Breast Cancer Res Treat. 2010 Apr;120(3):639-48. Epub 2010 Feb 12.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37.5kDa (352aa) confirmed by MALDI-TOF
NCBI Official Full Name
estradiol 17-beta-dehydrogenase 1 isoform 1
NCBI Official Synonym Full Names
hydroxysteroid 17-beta dehydrogenase 1
NCBI Official Symbol
HSD17B1
NCBI Official Synonym Symbols
E2DH; HSD17; EDHB17; EDH17B2; SDR28C1; 17-beta-HSD; 20-alpha-HSD
NCBI Protein Information
estradiol 17-beta-dehydrogenase 1
UniProt Protein Name
Estradiol 17-beta-dehydrogenase 1
UniProt Gene Name
HSD17B1
UniProt Synonym Gene Names
E17KSR; EDH17B1; EDH17B2; EDHB17; 17-beta-HSD 1; 20-alpha-HSD
UniProt Entry Name
DHB1_HUMAN

NCBI Description

This gene encodes a member of the 17beta-hydroxysteroid dehydrogenase family of short-chain dehydrogenases/reductases. It has a dual function in estrogen activation and androgen inactivation and plays a major role in establishing the estrogen E2 concentration gradient between serum and peripheral tissues. The encoded protein catalyzes the last step in estrogen activation, using NADPH to convert estrogens E1 and E2 and androgens like 4-androstenedione, to testosterone. It has an N-terminal short-chain dehydrogenase domain with a cofactor binding site, and a narrow, hydrophobic C-terminal domain with a steroid substrate binding site. This gene is expressed primarily in the placenta and ovarian granulosa cells, and to a lesser extent, in the endometrium, adipose tissue, and prostate. Polymorphisms in this gene have been linked to breast and prostate cancer. A pseudogene of this gene has been identified. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2016]

Uniprot Description

HSD17B1: Favors the reduction of estrogens and androgens. Also has 20-alpha-HSD activity. Uses preferentially NADH. Belongs to the short-chain dehydrogenases/reductases (SDR) family.

Protein type: Lipid Metabolism - androgen and estrogen; EC 1.1.1.62; Oxidoreductase

Chromosomal Location of Human Ortholog: 17q11-q21

Cellular Component: nucleoplasm; nuclear membrane; cytoplasm; cytosol

Molecular Function: estradiol 17-beta-dehydrogenase activity; catalytic activity; 3-alpha(17-beta)-hydroxysteroid dehydrogenase (NAD+) activity

Biological Process: steroid metabolic process; estrogen metabolic process; steroid biosynthetic process; estrogen biosynthetic process

Research Articles on HSD17B1

Similar Products

Product Notes

The HSD17B1 hsd17b1 (Catalog #AAA6158268) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HSD17B1 (E17KSR, EDH17B1, EDH17B2, EDHB17, Estradiol 17-beta-dehydrogenase 1, 17-beta-HSD 1, 20 alpha-hydroxysteroid Dehydrogenase, 20-alpha-HSD, E2DH, Placental 17-beta-hydroxysteroid Dehydrogenase, MGC138140) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HSD17B1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HSD17B1 hsd17b1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HSD17B1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.