Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human HRH3 Monoclonal Antibody | anti-HRH3 antibody

HRH3 (Histamine Receptor H3, H3R, HH3R, Histamine H3 Receptor, G-protein Coupled Receptor 97, GPCR97) (MaxLight 490)

Gene Names
HRH3; HH3R; GPCR97
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HRH3; Monoclonal Antibody; HRH3 (Histamine Receptor H3; H3R; HH3R; Histamine H3 Receptor; G-protein Coupled Receptor 97; GPCR97) (MaxLight 490); anti-HRH3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1D7
Specificity
Recognizes human HRH3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-HRH3 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa257-360 from HRH3 (NP_009163) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GCWGCWQKGHGEAMPLHRYGVGEAAVGAEAGEATLGGGGGGGSVASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMVSQSFTQRFRLSRDRKVAKS*
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-HRH3 antibody
HRH3 is a ubiquitous messenger molecule released from mast cells, enterochromaffin-like cells, and neurons. Its various actions are mediated by histamine receptors H1, H2, H3 and H4. This gene encodes one of the histamine receptors (H3) which belongs to the family 1 of G protein-coupled receptors. It is an integral membrane protein and can regulate neurotransmitter release. This receptor can also increase voltage-dependent calcium current in smooth muscles and innervates the blood vessels and the heart in cardiovascular system.
Product Categories/Family for anti-HRH3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45,607 Da
NCBI Official Full Name
histamine H3 receptor
NCBI Official Synonym Full Names
histamine receptor H3
NCBI Official Symbol
HRH3
NCBI Official Synonym Symbols
HH3R; GPCR97
NCBI Protein Information
histamine H3 receptor; G protein-coupled receptor 97; G-protein coupled receptor 97; H3R
UniProt Protein Name
Histamine H3 receptor
Protein Family
UniProt Gene Name
HRH3
UniProt Synonym Gene Names
GPCR97; H3R; HH3R
UniProt Entry Name
HRH3_HUMAN

Uniprot Description

H3R: The H3 subclass of histamine receptors could mediate the histamine signals in CNS and peripheral nervous system. Signals through the inhibition of adenylate cyclase and displays high constitutive activity (spontaneous activity in the absence of agonist). Agonist stimulation of isoform 3 niether modified adenylate cyclase activity nor induced intracellular calcium mobilization. Belongs to the G-protein coupled receptor 1 family. 7 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, GPCR; Membrane protein, integral; GPCR, family 1; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 20q13.33

Cellular Component: neuron projection; integral to plasma membrane; plasma membrane; myelin sheath

Molecular Function: drug binding; histamine receptor activity

Biological Process: negative regulation of glutamate secretion; eating behavior; neurotransmitter secretion; negative regulation of adenylate cyclase activity; negative regulation of gamma-aminobutyric acid secretion; drinking behavior; learning; regulation of norepinephrine secretion; response to organic cyclic substance; memory; G-protein signaling, coupled to cyclic nucleotide second messenger; negative regulation of serotonin secretion; elevation of cytosolic calcium ion concentration; negative regulation of blood pressure; brain development; positive regulation of epithelial cell proliferation

Similar Products

Product Notes

The HRH3 hrh3 (Catalog #AAA6201286) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HRH3 (Histamine Receptor H3, H3R, HH3R, Histamine H3 Receptor, G-protein Coupled Receptor 97, GPCR97) (MaxLight 490) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HRH3 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HRH3 hrh3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HRH3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.