Mouse anti-Human HPSE Monoclonal Antibody | anti-HPSE antibody

HPSE (Heparanase, Endo-glucoronidase, Heparanase-1, Hpa1, HEP, HPA, HPA1, HPR1, HPSE1, HSE1) (PE)

Cat. Num. AAA6158261

• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: HPSE; Monoclonal Antibody; HPSE (Heparanase; Endo-glucoronidase; Heparanase-1; Hpa1; HEP; HPA; HPA1; HPR1; HPSE1; HSE1) (PE); anti-HPSE antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 4D7
• Specificity: Recognizes human HPSE.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Concentration: 1mg/mL (varies by lot)
• Sequence: LILLGSPKLRTLARGLSPAYLRFGGTKTDFLIFDPKKESTFEERSY; WQSQVNQDICKYGSIPPDVEEKLRLEWPYQEQLLLREHYQKKFKNSTYSRSSV
• Sequence Length: 543

• Applicable Applications for anti-HPSE antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Suitable for use in ELISA and Western Blot.; Other applications not tested; ; Optimal dilutions to be determined by the researcher.
• Immunogen: Partial recombinant corresponding to aa72-170 from human HPSE (NP_006656) with GST tag. MW of the GST tag alone is 26kD.
• Grade: Affinity purified
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer; ; Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged HPSE is ~0.3ng/ml using (MBS6158261) as a capture antibody.)

Western Blot (WB)

(Western Blot detection against Immunogen using (MBS6158261) (37kD).)

Related Product Information for anti-HPSE antibody

Endoglycosidase that cleaves heparan sulfate proteoglycans (HSPGs) into heparan sulfate side chains and core proteoglycans. Participates in extracellular matrix (ECM) degradation and remodeling. Selectively cleaves the linkage between a glucuronic acid unit and an N-sulfo glucosamine unit carrying either a 3-O-sulfo or a 6-O-sulfo group. Can also cleave the linkage between a glucuronic acid unit and an N-sulfo glucosamine unit carrying a 2-O-sulfo group, but not linkages between a glucuronic acid unit and a 2-O-sulfated iduronic acid moiety. It is essentially inactive at neutral pH but becomes active under acidic conditions such as during tumor invasion and in inflammatory processes. Facilitates cell migration associated with metastasis, wound healing and inflammation. Enhances shedding of syndecans, and increases endothelial invasion and angiogenesis in myelomas. Acts as procoagulant by increasing the generation of activation factor X in the presence of tissue factor and activation factor VII. Increases cell adhesion to the extacellular matrix (ECM), independent of its enzymatic activity. Induces AKT1/PKB phosphorylation via lipid rafts increasing cell mobility and invasion. Heparin increases this AKT1/PKB activation. Regulates osteogenesis. Enhances angiogenesis through up-regulation of SRC-mediated activation of VEGF. Implicated in hair follicle inner root sheath differentiation and hair homeostasis.

Product Categories/Family for anti-HPSE antibody

Antibodies; Enzymes; Heparanase

NCBI and Uniprot Product Information

• NCBI GI #: 5729873
• NCBI Accession #: NP_006656.1
• NCBI GenBank Nucleotide #: NM_006665
• NCBI Official Full Name: heparanase
• Protein Family: Heparanase