Mouse anti-Human HPRT1 Monoclonal Antibody | anti-HPRT1 antibody

HPRT1 (Hypoxanthine Phosphoribosyltransferase 1, HGPRT, HGPRTase, HPRT, Hypoxanthine-guanine Phosphoribosyltransferase) (HRP)

Cat. Num. AAA6152957

• Gene Names: HPRT1; HPRT; HGPRT
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: HPRT1; Monoclonal Antibody; HPRT1 (Hypoxanthine Phosphoribosyltransferase 1; HGPRT; HGPRTase; HPRT; Hypoxanthine-guanine Phosphoribosyltransferase) (HRP); anti-HPRT1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG
• Clone Number: 4C3-G8
• Specificity: Recognizes human HPRT1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-HPRT1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-218 from human HPRT1 (AAH00578) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (49.72kD).)

Western Blot (WB)

(HPRT1 monoclonal antibody Western Blot analysis of HPRT1 expression in MCF-7.)

Related Product Information for anti-HPRT1 antibody

HPRT is a transferase, which catalyzes conversion of hypoxanthine to inosine monophosphate and guanine to guanosine monophosphate via transfer of the 5-phosphoribosyl group from 5-phosphoribosyl 1-pyrophosphate. HPRT, which acts as a catalyst in the reaction between guanine and phosphoribosyl pyrophosphate to form GMP, functions primarily to salvage purines from degraded DNA to renewed purine synthesis.

Product Categories/Family for anti-HPRT1 antibody

Antibodies; Enzymes

References

1. Sorting Nexin 27 Interacts with Multidrug Resistance-associated Protein 4 (MRP4) and Mediates Internalization of MRP4. Hayashi H, Naoi S, Nakagawa T, Nishikawa T, Fukuda H, Imajoh-Ohmi S, Kondo A, Kubo K, Yabuki T, Hattori A, Hirouchi M, Sugiyama Y.J Biol Chem. 2012 Apr 27;287(18):15054-65. Epub 2012 Mar 12.

NCBI and Uniprot Product Information

• NCBI GI #: 34784789
• NCBI GeneID: 3251
• Molecular Weight: 24,579 Da
• NCBI Official Full Name: Homo sapiens hypoxanthine phosphoribosyltransferase 1, mRNA
• NCBI Official Synonym Full Names: hypoxanthine phosphoribosyltransferase 1
• NCBI Official Symbol: HPRT1
• NCBI Official Synonym Symbols: HPRT; HGPRT
• NCBI Protein Information: hypoxanthine-guanine phosphoribosyltransferase
• Protein Family: Hypoxanthine-guanine phosphoribosyltransferase

NCBI Description

The protein encoded by this gene is a transferase, which catalyzes conversion of hypoxanthine to inosine monophosphate and guanine to guanosine monophosphate via transfer of the 5-phosphoribosyl group from 5-phosphoribosyl 1-pyrophosphate. This enzyme plays a central role in the generation of purine nucleotides through the purine salvage pathway. Mutations in this gene result in Lesch-Nyhan syndrome or gout.[provided by RefSeq, Jun 2009]