Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (32.56kD).)

Mouse anti-Human HOXD4 Monoclonal Antibody | anti-HOXD4 antibody

HOXD4 (HOX4B, Homeobox Protein Hox-D4, Homeobox Protein HHO.C13, Homeobox Protein Hox-4B, Homeobox Protein Hox-5.1) (FITC)

Gene Names
HOXD4; HOX4; HOX4B; HHO.C13; HOX-5.1; Hox-4.2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HOXD4; Monoclonal Antibody; HOXD4 (HOX4B; Homeobox Protein Hox-D4; Homeobox Protein HHO.C13; Homeobox Protein Hox-4B; Homeobox Protein Hox-5.1) (FITC); anti-HOXD4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1H7
Specificity
Recognizes human HOXD4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-HOXD4 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-62 from human HOXD4 (NP_055436.2) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MVMSSYMVNSKYVDPKFPPCEEYLQGGYLGEQGADYYGGGAQGADFQPPGLYPRPDFGEQPF
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (32.56kD).)

Western Blot (WB) (Western Blot detection against Immunogen (32.56kD).)

Testing Data

(Detection limit for recombinant GST tagged HOXD4 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged HOXD4 is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-HOXD4 antibody
This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located at 2q31-2q37 chromosome regions. Deletions that removed the entire HOXD gene cluster or 5' end of this cluster have been associated with severe limb and genital abnormalities. The protein encoded by this gene may play a role in determining positional values in developing limb buds. Alternatively spliced variants have been described but their full length nature has not been determined.
Product Categories/Family for anti-HOXD4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27,885 Da
NCBI Official Full Name
homeobox protein Hox-D4
NCBI Official Synonym Full Names
homeobox D4
NCBI Official Symbol
HOXD4
NCBI Official Synonym Symbols
HOX4; HOX4B; HHO.C13; HOX-5.1; Hox-4.2
NCBI Protein Information
homeobox protein Hox-D4; homeobox protein Hox-4B; homeobox protein HHO.C13; homeobox protein Hox-5.1; Hox-4.2, mouse, homolog of homeo box X
UniProt Protein Name
Homeobox protein Hox-D4
Protein Family
UniProt Gene Name
HOXD4
UniProt Synonym Gene Names
HOX4B
UniProt Entry Name
HXD4_HUMAN

Similar Products

Product Notes

The HOXD4 hoxd4 (Catalog #AAA6147647) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HOXD4 (HOX4B, Homeobox Protein Hox-D4, Homeobox Protein HHO.C13, Homeobox Protein Hox-4B, Homeobox Protein Hox-5.1) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HOXD4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HOXD4 hoxd4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HOXD4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.