Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged HOXB9 is 1 ng/ml as a capture antibody.)

Mouse HOXB9 Monoclonal Antibody | anti-HOXB9 antibody

HOXB9 (Homeobox B9, HOX-2.5, HOX2, HOX2E) (HRP)

Gene Names
HOXB9; HOX2; HOX2E; HOX-2.5
Applications
Immunoprecipitation, Western Blot
Purity
Purified
Synonyms
HOXB9; Monoclonal Antibody; HOXB9 (Homeobox B9; HOX-2.5; HOX2; HOX2E) (HRP); Homeobox B9; HOX2E; anti-HOXB9 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
200000000
Specificity
Recognizes HOXB9.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-HOXB9 antibody
Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
HOXB9 (NP_076922.1, 65aa-163aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PLSPHASGSLPSVYHPYIQPQGVPPAESRYLRTWLEPAPRGEAAPGQGQAAVKAEPLLGAPGELLKQGTPEYSLETSAGREAVLSNQRPGYGDNKICEG
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged HOXB9 is 1 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged HOXB9 is 1 ng/ml as a capture antibody.)

Western Blot (WB)

(Western Blot analysis of HOXB9 expression in transfected 293T cell line by HOXB9 monoclonal antibody (M29), clone 2E8.Lane 1: HOXB9 transfected lysate (28.1 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of HOXB9 expression in transfected 293T cell line by HOXB9 monoclonal antibody (M29), clone 2E8.Lane 1: HOXB9 transfected lysate (28.1 KDa).Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of HOXB9 transfected lysate using anti-HOXB9 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with HOXB9 MaxPab rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of HOXB9 transfected lysate using anti-HOXB9 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with HOXB9 MaxPab rabbit polyclonal antibody.)
Product Categories/Family for anti-HOXB9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28,059 Da
NCBI Official Full Name
homeobox protein Hox-B9
NCBI Official Synonym Full Names
homeobox B9
NCBI Official Symbol
HOXB9
NCBI Official Synonym Symbols
HOX2; HOX2E; HOX-2.5
NCBI Protein Information
homeobox protein Hox-B9; homeo box 2E; homeo box B9; homeobox protein Hox-2E; homeobox protein Hox-2.5
UniProt Protein Name
Homeobox protein Hox-B9
Protein Family
UniProt Gene Name
HOXB9
UniProt Synonym Gene Names
HOX2E
UniProt Entry Name
HXB9_HUMAN

NCBI Description

This gene is a member of the Abd-B homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded nuclear protein functions as a sequence-specific transcription factor that is involved in cell proliferation and differentiation. Increased expression of this gene is associated with some cases of leukemia, prostate cancer and lung cancer. [provided by RefSeq, Jul 2008]

Uniprot Description

HOXB9: Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Belongs to the Abd-B homeobox family.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 17q21.3

Cellular Component: nucleoplasm; mitochondrion

Molecular Function: protein binding; sequence-specific DNA binding

Biological Process: anterior/posterior pattern formation; mammary gland development; transcription, DNA-dependent; embryonic skeletal development; positive regulation of transcription from RNA polymerase II promoter; Wnt receptor signaling pathway through beta-catenin

Research Articles on HOXB9

Similar Products

Product Notes

The HOXB9 hoxb9 (Catalog #AAA6182392) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's HOXB9 can be used in a range of immunoassay formats including, but not limited to, Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HOXB9 hoxb9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HOXB9, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.