Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged HOXB7 is approximately 0.03ng/ml as a capture antibody.)

Mouse HOXB7 Monoclonal Antibody | anti-HOXB7 antibody

HOXB7 (Homeobox B7, HHO.C1, HOX2, HOX2C, Hox-2.3) (Biotin)

Gene Names
HOXB7; HOX2; HOX2C; HHO.C1; Hox-2.3
Applications
Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
HOXB7; Monoclonal Antibody; HOXB7 (Homeobox B7; HHO.C1; HOX2; HOX2C; Hox-2.3) (Biotin); Homeobox B7; Hox-2.3; anti-HOXB7 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4C6
Specificity
Recognizes HOXB7.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-HOXB7 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
HOXB7 (NP_004493, 55aa-120aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MQGLYPGGGGMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAA
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged HOXB7 is approximately 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged HOXB7 is approximately 0.03ng/ml as a capture antibody.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to HOXB7 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 1.5 ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to HOXB7 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 1.5 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to HOXB7 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 1.5 ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to HOXB7 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 1.5 ug/ml])
Related Product Information for anti-HOXB7 antibody
This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded nuclear protein functions as a sequence-specific transcription factor that is involved in cell proliferation and differentiation. Increased expression of this gene is associated with some cases of melanoma and ovarian carcinoma. [provided by RefSeq]
Product Categories/Family for anti-HOXB7 antibody
References
1. A novel predictive equation for potential diagnosis of cholangiocarcinoma.Kraiklang R, Pairojkul C, Khuntikeo N, Imtawil K, Wongkham S, Wongkham CPLoS One. 2014 Feb 28;9(2):e89337. doi: 10.1371/journal.pone.0089337. eCollection 2014.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
homeobox protein Hox-B7
NCBI Official Synonym Full Names
homeobox B7
NCBI Official Symbol
HOXB7
NCBI Official Synonym Symbols
HOX2; HOX2C; HHO.C1; Hox-2.3
NCBI Protein Information
homeobox protein Hox-B7
UniProt Protein Name
Homeobox protein Hox-B7
Protein Family
UniProt Gene Name
HOXB7
UniProt Synonym Gene Names
HOX2C
UniProt Entry Name
HXB7_HUMAN

NCBI Description

This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded nuclear protein functions as a sequence-specific transcription factor that is involved in cell proliferation and differentiation. Increased expression of this gene is associated with some cases of melanoma and ovarian carcinoma. [provided by RefSeq, Jul 2008]

Uniprot Description

HOXB7: Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Belongs to the Antp homeobox family.

Protein type: Motility/polarity/chemotaxis; DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 17q21.3

Cellular Component: nucleoplasm; cytoplasm; nucleus

Molecular Function: protein binding; sequence-specific DNA binding; transcription factor activity

Biological Process: anterior/posterior pattern formation; regulation of transcription, DNA-dependent; transcription, DNA-dependent; multicellular organismal development; myeloid cell differentiation; embryonic skeletal morphogenesis

Research Articles on HOXB7

Similar Products

Product Notes

The HOXB7 hoxb7 (Catalog #AAA6171842) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's HOXB7 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HOXB7 hoxb7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HOXB7, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.