Mouse HOXB6 Monoclonal Antibody | anti-HOXB6 antibody

HOXB6 (Homeobox B6, HOX2, HOX2B, HU-2, Hox-2.2) (HRP)

Cat. Num. AAA6183426

• Applications: Western Blot
• Purity: Purified
• Synonyms: HOXB6; Monoclonal Antibody; HOXB6 (Homeobox B6; HOX2; HOX2B; HU-2; Hox-2.2) (HRP); Homeobox B6; Hox-2.2; anti-HOXB6 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 8000
• Specificity: Recognizes HOXB6.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-HOXB6 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: HOXB6 (NP_724779.1, 1aa-57aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MSSYFVNSTFPVTLASGQESFLGQLPLYSSGYADPLRHYPAPYGPGPGQDKGFATSS
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged HOXB6 is 0.03 ng/ml as a capture antibody.)

Western Blot (WB)

(Western Blot analysis of HOXB6 expression in transfected 293T cell line by HOXB6 monoclonal antibody (M01), clone 8E3.Lane 1: HOXB6 transfected lysate (Predicted MW: 25.4 KDa).Lane 2: Non-transfected lysate.)

Product Categories/Family for anti-HOXB6 antibody

Antibodies; Transcription Factors; Homeobox (HOX)

NCBI and Uniprot Product Information

• NCBI GI #: 24797137
• Protein Family: Homeobox protein