Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of HOXB1 expression in transfected 293T cell line by HOXB1 monoclonal antibody (M06), clone 2F12.Lane 1: HOXB1 transfected lysate (25 KDa).Lane 2: Non-transfected lysate.)

Mouse HOXB1 Monoclonal Antibody | anti-HOXB1 antibody

HOXB1 (Homeobox B1, HOX2, HOX2I, Hox-2.9, MGC116843, MGC116844, MGC116845) (PE)

Gene Names
HOXB1; HOX2; HOX2I; Hox-2.9; MGC116843; MGC116844; MGC116845
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified
Synonyms
HOXB1; Monoclonal Antibody; HOXB1 (Homeobox B1; HOX2; HOX2I; Hox-2.9; MGC116843; MGC116844; MGC116845) (PE); Homeobox B1; MGC116845; anti-HOXB1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F12
Specificity
Recognizes HOXB1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-HOXB1 antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
HOXB1 (NP_002135.2, 101aa-210aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LGQSEGDGGYFHPSSYGAQLGGLSDGYGAGGAGPGPYPPQHPPYGNEQTASFAPAYADLLSEDKETPCPSEPNTPTARTFDWMKVKRNPPKTAKVSEPGLGSPSGLRTNF
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of HOXB1 expression in transfected 293T cell line by HOXB1 monoclonal antibody (M06), clone 2F12.Lane 1: HOXB1 transfected lysate (25 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of HOXB1 expression in transfected 293T cell line by HOXB1 monoclonal antibody (M06), clone 2F12.Lane 1: HOXB1 transfected lysate (25 KDa).Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of HOXB1 transfected lysate using anti-HOXB1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with HOXB1 MaxPab rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of HOXB1 transfected lysate using anti-HOXB1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with HOXB1 MaxPab rabbit polyclonal antibody.)
Related Product Information for anti-HOXB1 antibody
This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXB genes located in a cluster on chromosome 17. [provided by RefSeq]
Product Categories/Family for anti-HOXB1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32,193 Da
NCBI Official Full Name
homeobox protein Hox-B1
NCBI Official Synonym Full Names
homeobox B1
NCBI Official Symbol
HOXB1
NCBI Official Synonym Symbols
HOX2; HOX2I; Hox-2.9; MGC116843; MGC116844; MGC116845
NCBI Protein Information
homeobox protein Hox-B1; homeo box 2I; homeo box B1; OTTHUMP00000217086; homeobox protein Hox-2I
UniProt Protein Name
Homeobox protein Hox-B1
Protein Family
UniProt Gene Name
HOXB1
UniProt Synonym Gene Names
HOX2I
UniProt Entry Name
HXB1_HUMAN

Similar Products

Product Notes

The HOXB1 hoxb1 (Catalog #AAA6184790) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's HOXB1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HOXB1 hoxb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HOXB1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.