Mouse anti-Human HOXA6 Monoclonal Antibody | anti-HOXA6 antibody

HOXA6 (Homeobox Protein Hox-A6, Homeobox Protein Hox-1B, HOX1B) (PE)

Cat. Num. AAA6158235

• Gene Names: HOXA6; HOX1; HOX1B; HOX1.2
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: HOXA6; Monoclonal Antibody; HOXA6 (Homeobox Protein Hox-A6; Homeobox Protein Hox-1B; HOX1B) (PE); anti-HOXA6 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3A6
• Specificity: Recognizes human HOXA6.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-HOXA6 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa31-130 from human HOXA6 (NP_076919) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: GYDALRPFPASYGASSLPDKTYTSPCFYQQSNSVLACNRASYEYGASCFYSDKDLSGASPSGSGKQRGPGDYLHFSPEQQYKPDSSSGQGKALHDEGADR
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Testing Data

(Detection limit for recombinant GST tagged HOXA6 is ~1ng/ml as a capture antibody.)

Related Product Information for anti-HOXA6 antibody

Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.

Product Categories/Family for anti-HOXA6 antibody

Antibodies; Transcription Factors; Homeobox (HOX)

References

1. Leukemic fusion genes MLL/AF4 and AML1/MTG8 support leukemic self-renewal by controlling expression of the telomerase subunit TERT. Gessner A, Thomas M, Garrido Castro P, Buchler L, Scholz A, Brummendorf TH, Martinez Soria N, Vormoor J, Greil J, Heidenreich O.Leukemia. 2010 Aug 5.

NCBI and Uniprot Product Information

• NCBI GI #: 13489077
• NCBI GeneID: 3203
• NCBI Accession #: NP_076919
• NCBI GenBank Nucleotide #: NM_024014
• UniProt Accession #: P31267
• Molecular Weight: 25kDa
• NCBI Official Full Name: homeobox protein Hox-A6
• NCBI Official Synonym Full Names: homeobox A6
• NCBI Official Symbol: HOXA6
• NCBI Official Synonym Symbols: HOX1; HOX1B; HOX1.2
• NCBI Protein Information: homeobox protein Hox-A6
• UniProt Protein Name: Homeobox protein Hox-A6
• Protein Family: Homeobox protein
• UniProt Gene Name: HOXA6
• UniProt Synonym Gene Names: HOX1B
• UniProt Entry Name: HXA6_HUMAN

NCBI Description

In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. [provided by RefSeq, Jul 2008]

Uniprot Description

HOXA6: Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Belongs to the Antp homeobox family.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 7p15.2

Cellular Component: nucleus

Molecular Function: sequence-specific DNA binding; transcription factor activity

Biological Process: anterior/posterior pattern formation; transcription, DNA-dependent; regulation of transcription, DNA-dependent; embryonic skeletal morphogenesis