Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human HMGN3 Monoclonal Antibody | anti-HMGN3 antibody

HMGN3 (HMGN-3, High Mobility Group Nucleosomal Binding Domain 3, TRIP7, TRIP-7, Thyroid Hormone Receptor Interacting Protein 7, PNAS-24, PNAS-25)

Gene Names
HMGN3; TRIP7; PNAS-24; PNAS-25
Reactivity
Human
Applications
ELISA
Purity
Ascites
Ascites
Synonyms
HMGN3; Monoclonal Antibody; HMGN3 (HMGN-3; High Mobility Group Nucleosomal Binding Domain 3; TRIP7; TRIP-7; Thyroid Hormone Receptor Interacting Protein 7; PNAS-24; PNAS-25); Anti -HMGN3 (HMGN-3; anti-HMGN3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgM,k
Clone Number
3E17
Specificity
Recognizes human HMGN3.
Purity/Purification
Ascites
Ascites
Form/Format
Supplied as a liquid in ascites fluid.
Sequence
MPKRKSPENTEGKDGSKVTKQEPTRRSARLSAKPAPPKPEPKPRKTSAKKEPGAKISRGAKGKKEEKQEAGKEGTEN
Applicable Applications for anti-HMGN3 antibody
ELISA (EL/EIA)
Application Notes
Suitable for use in ELISA.
Immunogen
Full-length recombinant corresponding to aa1-77 from HMGN3 (AAH09529.1) with GST tag.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Related Product Information for anti-HMGN3 antibody
Thyroid hormone receptors are hormone-dependent transcription factors that regulate expression of a variety of specific target genes. The protein encoded by this gene binds thyroid hormone receptor beta, but only in the presence of thyroid hormone. The encoded protein, a member of the HMGN protein family, is thought to reduce the compactness of the chromatin fiber in nucleosomes, thereby enhancing transcription from chromatin templates. Two transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-HMGN3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
10,666 Da
NCBI Official Full Name
high mobility group nucleosome-binding domain-containing protein 3 isoform HMGN3d
NCBI Official Synonym Full Names
high mobility group nucleosomal binding domain 3
NCBI Official Symbol
HMGN3
NCBI Official Synonym Symbols
TRIP7; PNAS-24; PNAS-25
NCBI Protein Information
high mobility group nucleosome-binding domain-containing protein 3; TR-interacting protein 7; thyroid hormone receptor interacting protein 7
UniProt Protein Name
High mobility group nucleosome-binding domain-containing protein 3
UniProt Gene Name
HMGN3
UniProt Synonym Gene Names
TRIP7; TR-interacting protein 7; TRIP-7
UniProt Entry Name
HMGN3_HUMAN

NCBI Description

Thyroid hormone receptors are hormone-dependent transcription factors that regulate expression of a variety of specific target genes. The protein encoded by this gene binds thyroid hormone receptor beta, but only in the presence of thyroid hormone. The encoded protein, a member of the HMGN protein family, is thought to reduce the compactness of the chromatin fiber in nucleosomes, thereby enhancing transcription from chromatin templates. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2011]

Uniprot Description

HMGN3: Binds to nucleosomes, regulating chromatin structure and consequently, chromatin-dependent processes such as transcription, DNA replication and DNA repair. Affects both insulin and glucagon levels and modulates the expression of pancreatic genes involved in insulin secretion. Regulates the expression of the glucose transporter SLC2A2 by binding specifically to its promoter region and recruiting PDX1 and additional transcription factors. Regulates the expression of SLC6A9, a glycine transporter which regulates the glycine concentration in synaptic junctions in the central nervous system, by binding to its transcription start site. May play a role in ocular development and astrocyte function. Belongs to the HMGN family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 6q14.1

Cellular Component: nucleoplasm; cytoplasm; chromatin

Molecular Function: nucleosomal DNA binding; thyroid hormone receptor binding

Biological Process: chromatin modification

Research Articles on HMGN3

Similar Products

Product Notes

The HMGN3 hmgn3 (Catalog #AAA6005819) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HMGN3 (HMGN-3, High Mobility Group Nucleosomal Binding Domain 3, TRIP7, TRIP-7, Thyroid Hormone Receptor Interacting Protein 7, PNAS-24, PNAS-25) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HMGN3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA). Suitable for use in ELISA. Researchers should empirically determine the suitability of the HMGN3 hmgn3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MPKRKSPENT EGKDGSKVTK QEPTRRSARL SAKPAPPKPE PKPRKTSAKK EPGAKISRGA KGKKEEKQEA GKEGTEN. It is sometimes possible for the material contained within the vial of "HMGN3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.