Mouse anti-Human HMGN3 Monoclonal Antibody | anti-HMGN3 antibody

HMGN3 (HMGN-3, High Mobility Group Nucleosomal Binding Domain 3, TRIP7, TRIP-7, Thyroid Hormone Receptor Interacting Protein 7, PNAS-24, PNAS-25)

Cat. Num. AAA6005819

• Gene Names: HMGN3; TRIP7; PNAS-24; PNAS-25
• Reactivity: Human
• Applications: ELISA
• Purity: Ascites; Ascites
• Synonyms: HMGN3; Monoclonal Antibody; HMGN3 (HMGN-3; High Mobility Group Nucleosomal Binding Domain 3; TRIP7; TRIP-7; Thyroid Hormone Receptor Interacting Protein 7; PNAS-24; PNAS-25); Anti -HMGN3 (HMGN-3; anti-HMGN3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgM,k
• Clone Number: 3E17
• Specificity: Recognizes human HMGN3.
• Purity/Purification: Ascites; Ascites
• Form/Format: Supplied as a liquid in ascites fluid.
• Sequence: MPKRKSPENTEGKDGSKVTKQEPTRRSARLSAKPAPPKPEPKPRKTSAKKEPGAKISRGAKGKKEEKQEAGKEGTEN

• Applicable Applications for anti-HMGN3 antibody: ELISA (EL/EIA)
• Application Notes: Suitable for use in ELISA.
• Immunogen: Full-length recombinant corresponding to aa1-77 from HMGN3 (AAH09529.1) with GST tag.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Related Product Information for anti-HMGN3 antibody

Thyroid hormone receptors are hormone-dependent transcription factors that regulate expression of a variety of specific target genes. The protein encoded by this gene binds thyroid hormone receptor beta, but only in the presence of thyroid hormone. The encoded protein, a member of the HMGN protein family, is thought to reduce the compactness of the chromatin fiber in nucleosomes, thereby enhancing transcription from chromatin templates. Two transcript variants encoding different isoforms have been found for this gene.

Product Categories/Family for anti-HMGN3 antibody

Antibodies; Abs to Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 318067961
• NCBI GeneID: 9324
• NCBI Accession #: NP_001188292.1
• NCBI GenBank Nucleotide #: NM_001201363.1
• UniProt Accession #: Q15651; Q5HYD3; Q7RTT0; Q969M5; Q9BZT7; B2RD37
• Molecular Weight: 10,666 Da
• NCBI Official Full Name: high mobility group nucleosome-binding domain-containing protein 3 isoform HMGN3d
• NCBI Official Synonym Full Names: high mobility group nucleosomal binding domain 3
• NCBI Official Symbol: HMGN3
• NCBI Official Synonym Symbols: TRIP7; PNAS-24; PNAS-25
• NCBI Protein Information: high mobility group nucleosome-binding domain-containing protein 3; TR-interacting protein 7; thyroid hormone receptor interacting protein 7
• UniProt Protein Name: High mobility group nucleosome-binding domain-containing protein 3
• Protein Family: High mobility group nucleosome-binding domain-containing protein
• UniProt Gene Name: HMGN3
• UniProt Synonym Gene Names: TRIP7; TR-interacting protein 7; TRIP-7
• UniProt Entry Name: HMGN3_HUMAN

NCBI Description

Thyroid hormone receptors are hormone-dependent transcription factors that regulate expression of a variety of specific target genes. The protein encoded by this gene binds thyroid hormone receptor beta, but only in the presence of thyroid hormone. The encoded protein, a member of the HMGN protein family, is thought to reduce the compactness of the chromatin fiber in nucleosomes, thereby enhancing transcription from chromatin templates. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2011]

Uniprot Description

HMGN3: Binds to nucleosomes, regulating chromatin structure and consequently, chromatin-dependent processes such as transcription, DNA replication and DNA repair. Affects both insulin and glucagon levels and modulates the expression of pancreatic genes involved in insulin secretion. Regulates the expression of the glucose transporter SLC2A2 by binding specifically to its promoter region and recruiting PDX1 and additional transcription factors. Regulates the expression of SLC6A9, a glycine transporter which regulates the glycine concentration in synaptic junctions in the central nervous system, by binding to its transcription start site. May play a role in ocular development and astrocyte function. Belongs to the HMGN family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 6q14.1

Cellular Component: nucleoplasm; cytoplasm; chromatin

Molecular Function: nucleosomal DNA binding; thyroid hormone receptor binding

Biological Process: chromatin modification