Mouse anti-Human HMGCS2 Monoclonal Antibody | anti-HMGCS2 antibody

HMGCS2 (3-hydroxy-3-methylglutaryl Coenzyme A Synthase 2, Hydroxymethylglutaryl-CoA Synthase Mitochondrial, HMG-CoA Synthase) (AP)

Cat. Num. AAA6131700

• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: HMGCS2; Monoclonal Antibody; HMGCS2 (3-hydroxy-3-methylglutaryl Coenzyme A Synthase 2; Hydroxymethylglutaryl-CoA Synthase Mitochondrial; HMG-CoA Synthase) (AP); anti-HMGCS2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1E9
• Specificity: Recognizes human HMGCS2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-HMGCS2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa424-508 from human HMGCS2 (NP_005509.1) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: RVSQDAAPGSPLDKLVSSTSDLPKRLASRKCVSPEEFTEIMNQREQFYHKVNFSPPGDTNSLFPGTWYLERVDEQHRRKYARRPV
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.09kD))

Western Blot (WB)

(Western Blot analysis of HMGCS2 expression in transfected 293T cell line by HMGCS2 monoclonal antibody. Lane 1: HMGCS2 transfected lysate (56.6kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged HMGCS2 is ~1ng/ml as a capture antibody.)

Related Product Information for anti-HMGCS2 antibody

HMGCS2 belongs to the HMG-CoA synthase family. It is a mitochondrial enzyme that catalyzes the first reaction of ketogenesis, a metabolic pathway that provides lipid-derived energy for various organs during times of carbohydrate deprivation, such as fasting.

Product Categories/Family for anti-HMGCS2 antibody

Antibodies; Coenzyme A

NCBI and Uniprot Product Information

• NCBI GI #: 5031751
• NCBI GeneID: 3158
• NCBI Accession #: NP_005509.1
• NCBI GenBank Nucleotide #: NM_005518
• UniProt Accession #: P54868; Q5SZU2; Q6IBF4; B7Z8R3; D3Y5K6
• Molecular Weight: 50,050 Da
• NCBI Official Full Name: hydroxymethylglutaryl-CoA synthase, mitochondrial isoform 1
• NCBI Official Synonym Full Names: 3-hydroxy-3-methylglutaryl-CoA synthase 2 (mitochondrial)
• NCBI Official Symbol: HMGCS2
• NCBI Protein Information: hydroxymethylglutaryl-CoA synthase, mitochondrial; HMG-CoA synthase; 3-hydroxy-3-methylglutaryl-Coenzyme A synthase 2 (mitochondrial)
• UniProt Protein Name: Hydroxymethylglutaryl-CoA synthase, mitochondrial
• UniProt Gene Name: HMGCS2
• UniProt Synonym Gene Names: HMG-CoA synthase
• UniProt Entry Name: HMCS2_HUMAN

NCBI Description

The protein encoded by this gene belongs to the HMG-CoA synthase family. It is a mitochondrial enzyme that catalyzes the first reaction of ketogenesis, a metabolic pathway that provides lipid-derived energy for various organs during times of carbohydrate deprivation, such as fasting. Mutations in this gene are associated with HMG-CoA synthase deficiency. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Oct 2009]