Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (HMGB2 monoclonal antibody (M02), clone 4G7 Western Blot analysis of HMGB2 expression in K-562.)

Mouse HMGB2 Monoclonal Antibody | anti-HMGB2 antibody

HMGB2 (High-Mobility Group Box 2, HMG2) (AP)

Applications
Western Blot
Purity
Purified
Synonyms
HMGB2; Monoclonal Antibody; HMGB2 (High-Mobility Group Box 2; HMG2) (AP); High-Mobility Group Box 2; HMG2; anti-HMGB2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4G7
Specificity
Recognizes HMGB2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-HMGB2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
HMGB2 (AAH00903.2, 1aa-195aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEE
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(HMGB2 monoclonal antibody (M02), clone 4G7 Western Blot analysis of HMGB2 expression in K-562.)

Western Blot (WB) (HMGB2 monoclonal antibody (M02), clone 4G7 Western Blot analysis of HMGB2 expression in K-562.)

Western Blot (WB)

(Western Blot analysis of HMGB2 expression in transfected 293T cell line by HMGB2 monoclonal antibody (M02), clone 4G7.Lane 1: HMGB2 transfected lysate(22 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of HMGB2 expression in transfected 293T cell line by HMGB2 monoclonal antibody (M02), clone 4G7.Lane 1: HMGB2 transfected lysate(22 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB)

(HMGB2 monoclonal antibody (M02), clone 4G7. Western Blot analysis of HMGB2 expression in Hela S3 NE.)

Western Blot (WB) (HMGB2 monoclonal antibody (M02), clone 4G7. Western Blot analysis of HMGB2 expression in Hela S3 NE.)

Testing Data

(Detection limit for recombinant GST tagged HMGB2 is approximately 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged HMGB2 is approximately 0.03ng/ml as a capture antibody.)
Related Product Information for anti-HMGB2 antibody
This gene encodes a member of the non-histone chromosomal high mobility group protein family. The proteins of this family are chromatin-associated and ubiquitously distributed in the nucleus of higher eukaryotic cells. In vitro studies have demonstrated that this protein is able to efficiently bend DNA and form DNA circles. These studies suggest a role in facilitating cooperative interactions between cis-acting proteins by promoting DNA flexibility. This protein was also reported to be involved in the final ligation step in DNA end-joining processes of DNA double-strand breaks repair and V(D)J recombination. [provided by RefSeq]
Product Categories/Family for anti-HMGB2 antibody

NCBI and Uniprot Product Information

NCBI GI #

Similar Products

Product Notes

The HMGB2 (Catalog #AAA6162687) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's HMGB2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HMGB2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HMGB2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.