Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of KDM5B expression in rat testis extract (lane 1), mouse testis extract (lane 2) and HEPG2 whole cell lysates (lane 3). KDM5B at 175KD was detected using rabbit anti- KDM5B Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Rabbit KDM5B Polyclonal Antibody | anti-KDM5B antibody

Anti-KDM5B Antibody

Gene Names
KDM5B; CT31; PLU1; PUT1; PLU-1; JARID1B; PPP1R98; RBP2-H1; RBBP2H1A
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Immunogen affinity purified.
Synonyms
KDM5B; Polyclonal Antibody; Anti-KDM5B Antibody; CT31; JARID1B; Kdm5b; PLU-1; PLU1; PPP1R98; PUT1; RBBP2H1A; RBP2-H1; Q9UGL1; Lysine-specific demethylase 5B; lysine demethylase 5B; anti-KDM5B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
1580
Applicable Applications for anti-KDM5B antibody
Western Blot (WB)
Application Notes
Western Blot: 0.1-0.5ug/ml
Notes
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human KDM5B (641-685aa DVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFE LL), identical to the related mouse and rat sequences.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of KDM5B expression in rat testis extract (lane 1), mouse testis extract (lane 2) and HEPG2 whole cell lysates (lane 3). KDM5B at 175KD was detected using rabbit anti- KDM5B Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Western Blot (WB) (Western blot analysis of KDM5B expression in rat testis extract (lane 1), mouse testis extract (lane 2) and HEPG2 whole cell lysates (lane 3). KDM5B at 175KD was detected using rabbit anti- KDM5B Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )
Related Product Information for anti-KDM5B antibody
Rabbit IgG polyclonal antibody for Lysine-specific demethylase 5B(KDM5B) detection.
Background: Lysine-specific demethylase 5B, also known as histone demethylase JARID1B, is a demethylase enzyme that in humans is encoded by the KDM5B gene. This gene encodes a lysine-specific histone demethylase that belongs to the jumonji/ARID domain-containing family of histone demethylases. The encoded protein is capable of demethylating tri-, di- and monomethylated lysine 4 of histone H3. This protein plays a role in the transcriptional repression or certain tumor suppressor genes and is upregulated in certain cancer cells. This protein may also play a role in genome stability and DNA repair. Alternate splicing resultsi n multiple transcript variants.
References
1. Lahoud MH, Ristevski S, Venter DJ, Jermiin LS, Bertoncello I, Zavarsek S, Hasthorpe S, Drago J, de Kretser D, Hertzog PJ, Kola I (August 2001). "Gene targeting of Desrt, a novel ARID class DNA-binding protein, causes growth retardation and abnormal development of reproductive organs". Genome Research 11(8): 1327-34.
2. Zhu L, Hu J, Lin D, Whitson R, Itakura K, Chen Y (August 2001). "Dynamics of the Mrf-2 DNA-binding domain free and in complex with DNA". Biochemistry 40 (31): 9142-50.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
179,409 Da
NCBI Official Full Name
lysine-specific demethylase 5B isoform 1
NCBI Official Synonym Full Names
lysine demethylase 5B
NCBI Official Symbol
KDM5B
NCBI Official Synonym Symbols
CT31; PLU1; PUT1; PLU-1; JARID1B; PPP1R98; RBP2-H1; RBBP2H1A
NCBI Protein Information
lysine-specific demethylase 5B
UniProt Protein Name
Lysine-specific demethylase 5B
UniProt Gene Name
KDM5B
UniProt Synonym Gene Names
JARID1B; PLU1; RBBP2H1; CT31; RBP2-H1

NCBI Description

This gene encodes a lysine-specific histone demethylase that belongs to the jumonji/ARID domain-containing family of histone demethylases. The encoded protein is capable of demethylating tri-, di- and monomethylated lysine 4 of histone H3. This protein plays a role in the transcriptional repression or certain tumor suppressor genes and is upregulated in certain cancer cells. This protein may also play a role in genome stability and DNA repair. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Nov 2016]

Uniprot Description

JARID1B: Histone demethylase that demethylates 'Lys-4' of histone H3, thereby playing a central role in histone code. Does not demethylate histone H3 'Lys-9' or H3 'Lys-27'. Demethylates trimethylated, dimethylated and monomethylated H3 'Lys-4'. Acts as a transcriptional corepressor for FOXG1B and PAX9. Favors the proliferation of breast cancer cells by repressing tumor suppressor genes such as BRCA1 and HOXA5. In contrast, may act as a tumor suppressor for melanoma. Interacts with FOXG1B, PAX9, MYC, MYCN and RB1. Interacts with HDAC1, HDAC4, HDAC5 and HDAC7. Ubiquitously expressed, with highest levels in testis. Down-regulated in melanoma and glioblastoma. Up-regulated in breast cancer. Belongs to the JARID1 histone demethylase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cancer Testis Antigen (CTA); Demethylase; EC 1.14.11.-; Oxidoreductase; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 1q32.1

Cellular Component: cytoplasm; nucleoplasm; nucleus

Molecular Function: histone demethylase activity; histone demethylase activity (H3-K4 specific); protein binding; transcription corepressor activity; transcription factor activity

Research Articles on KDM5B

Similar Products

Product Notes

The KDM5B kdm5b (Catalog #AAA178829) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-KDM5B Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's KDM5B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the KDM5B kdm5b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KDM5B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.