Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Immunoperoxidase of monoclonal antibody to HMGB1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml])

Mouse HMGB1 Monoclonal Antibody | anti-HMGB1 antibody

HMGB1 (High-Mobility Group Box 1, DKFZp686A04236, HMG1, HMG3, SBP-1) (Biotin)

Gene Names
HMGB1; HMG1; HMG3; SBP-1
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
HMGB1; Monoclonal Antibody; HMGB1 (High-Mobility Group Box 1; DKFZp686A04236; HMG1; HMG3; SBP-1) (Biotin); High-Mobility Group Box 1; SBP-1; anti-HMGB1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F6
Specificity
Recognizes HMGB1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-HMGB1 antibody
Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
HMGB1 (NP_002119, 1aa-90aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFK
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to HMGB1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml])

Testing Data (Immunoperoxidase of monoclonal antibody to HMGB1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to HMGB1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to HMGB1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to HMGB1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to HMGB1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to HMGB1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to HMGB1 on HeLa cell. [antibody concentration 10 ug/ml])

Western Blot (WB)

(HMGB1 monoclonal antibody (M08), clone 2F6 Western Blot analysis of HMGB1 expression in Hela S3 NE.)

Western Blot (WB) (HMGB1 monoclonal antibody (M08), clone 2F6 Western Blot analysis of HMGB1 expression in Hela S3 NE.)

Testing Data

(Detection limit for recombinant GST tagged HMGB1 is approximately 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged HMGB1 is approximately 0.3ng/ml as a capture antibody.)
Related Product Information for anti-HMGB1 antibody
Mouse monoclonal antibody raised against a partial recombinant HMGB1.
Product Categories/Family for anti-HMGB1 antibody
References
1. The Anti-Inflammatory Activity of HMGB1 A Box Is Enhanced When Fused with C-Terminal Acidic Tail. Gong W, Zheng Y, Chao F, Li Y, Xu Z, Huang G, Gao X, Li S, He F.J Biomed Biotechnol. 2010;2010:915234. Epub 2010 Apr 1. 2.Functional dissection of an IFN-alpha/beta receptor 1 promoter variant that confers higher risk to chronic hepatitis B virus infection.Zhou J, Huang JD, Poon VK, Chen DQ, Chan CC, Ng F, Guan XY, Watt RM, Lu L, Yuen KY, Zheng BJ.J Hepatol. 2009 Aug;51(2):322-32. Epub 2009 May 3.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Predicted: 24 kDa

Observed: 24 kDa
NCBI Official Full Name
high mobility group protein B1
NCBI Official Synonym Full Names
high mobility group box 1
NCBI Official Symbol
HMGB1
NCBI Official Synonym Symbols
HMG1; HMG3; SBP-1
NCBI Protein Information
high mobility group protein B1; HMG-1; Amphoterin; high-mobility group box 1; high mobility group protein 1; Sulfoglucuronyl carbohydrate binding protein; high-mobility group (nonhistone chromosomal) protein 1
UniProt Protein Name
High mobility group protein B1
UniProt Gene Name
HMGB1
UniProt Synonym Gene Names
HMG1; HMG-1
UniProt Entry Name
HMGB1_HUMAN

Uniprot Description

HMGB1: DNA binding proteins that associates with chromatin and has the ability to bend DNA. Binds preferentially single-stranded DNA. Involved in V(D)J recombination by acting as a cofactor of the RAG complex. Acts by stimulating cleavage and RAG protein binding at the 23 bp spacer of conserved recombination signal sequences (RSS). Heparin-binding protein that has a role in the extension of neurite-type cytoplasmic processes in developing cells. Component of the RAG complex composed of core components RAG1 and RAG2, and associated component HMGB1 or HMGB2. Belongs to the HMGB family.

Protein type: DNA repair, damage; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 13q12

Cellular Component: nucleoplasm; extracellular space; cell surface; transcriptional repressor complex; extracellular region; condensed chromosome; nucleus

Molecular Function: protein binding; RAGE receptor binding; double-stranded DNA binding; damaged DNA binding; cytokine activity; chromatin binding; transcription factor activity; DNA bending activity; transcription factor binding; single-stranded DNA binding; chemoattractant activity

Biological Process: negative regulation of transcriptional preinitiation complex assembly; DNA topological change; V(D)J recombination; apoptosis; positive regulation of apoptosis; positive regulation of caspase activity; base-excision repair, DNA ligation; negative regulation of transcription from RNA polymerase II promoter; DNA recombination; chromatin remodeling; regulation of transcription from RNA polymerase II promoter; myeloid dendritic cell activation; inflammatory response to antigenic stimulus; positive chemotaxis; dendritic cell chemotaxis; innate immune response; DNA ligation during DNA repair; positive regulation of transcription from RNA polymerase II promoter; DNA fragmentation during apoptosis; neurite development; cell structure disassembly during apoptosis; positive regulation of DNA binding

Research Articles on HMGB1

Similar Products

Product Notes

The HMGB1 hmgb1 (Catalog #AAA6170428) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's HMGB1 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HMGB1 hmgb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HMGB1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.