Mouse HMGB1 Monoclonal Antibody | anti-HMGB1 antibody

HMGB1 (High-Mobility Group Box 1, DKFZp686A04236, HMG1, HMG3, SBP-1) (HRP)

Cat. Num. AAA6179246

• Gene Names: HMGB1; HMG1; HMG3; HMG-1; SBP-1
• Applications: Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: HMGB1; Monoclonal Antibody; HMGB1 (High-Mobility Group Box 1; DKFZp686A04236; HMG1; HMG3; SBP-1) (HRP); High-Mobility Group Box 1; SBP-1; anti-HMGB1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1B2
• Specificity: Recognizes HMGB1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 215

• Applicable Applications for anti-HMGB1 antibody: Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: HMGB1 (AAH03378.1, 1aa-215aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of HMGB1 expression in transfected 293T cell line by HMGB1 monoclonal antibody (M04), clone 1B2.Lane 1: HMGB1 transfected lysate (24.9 KDa).Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged HMGB1 is approximately 3ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to HMGB1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to HMGB1 on HeLa cell. [antibody concentration 10 ug/ml])

Product Categories/Family for anti-HMGB1 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 13097234
• NCBI GeneID: 3146
• NCBI Official Full Name: High-mobility group box 1
• NCBI Official Synonym Full Names: high mobility group box 1
• NCBI Official Symbol: HMGB1
• NCBI Official Synonym Symbols: HMG1; HMG3; HMG-1; SBP-1
• NCBI Protein Information: high mobility group protein B1
• Protein Family: High mobility group protein

NCBI Description

This gene encodes a protein that belongs to the High Mobility Group-box superfamily. The encoded non-histone, nuclear DNA-binding protein regulates transcription, and is involved in organization of DNA. This protein plays a role in several cellular processes, including inflammation, cell differentiation and tumor cell migration. Multiple pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Sep 2015]