Mouse anti-Human HMG2 Monoclonal Antibody | anti-HMG2 antibody

HMG2 (High-mobility Group Box 2, High Mobility Group Protein B2, High Mobility Group Protein 2, HMG-2, HMGB2) (FITC)

Cat. Num. AAA6147601

• Gene Names: HMGB2; HMG2
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: HMG2; Monoclonal Antibody; HMG2 (High-mobility Group Box 2; High Mobility Group Protein B2; High Mobility Group Protein 2; HMG-2; HMGB2) (FITC); anti-HMG2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3C7
• Specificity: Recognizes human HMGB2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-HMG2 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 1.5ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-195 from HMGB2 (AAH00903.2) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEE
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (47.19kD).)

Western Blot (WB)

(HMGB2 monoclonal antibody Western Blot analysis of HMGB2 expression in Hela NE)

Western Blot (WB)

(Western Blot analysis of HMGB2 expression in transfected 293T cell line by HMGB2 monoclonal antibody Lane 1: HMGB2 transfected lysate (22kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to HMGB2 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 1.5ug/ml])

Testing Data

(Detection limit for recombinant GST tagged HMGB2 is ~0.3ng/ml as a capture antibody.)

Product Categories/Family for anti-HMG2 antibody

Antibodies; Transcription Factors

References

1. Overexpression of HMGB2 is associated with tumor aggressiveness and prognosis of hepatocellular carcinoma. Kwon JH, Kim J, Park JY, Hong SM, Park CW, Hong SJ, Park SY, Choi YJ, Do I, Joh JW, Kim DS, Choi KY.Clin Cancer Res. 2010 Sep 17.

NCBI and Uniprot Product Information

• NCBI GI #: 14705263
• NCBI GeneID: 3148
• Molecular Weight: 24,034 Da
• NCBI Official Full Name: Homo sapiens high-mobility group box 2, mRNA
• NCBI Official Synonym Full Names: high mobility group box 2
• NCBI Official Symbol: HMGB2
• NCBI Official Synonym Symbols: HMG2
• NCBI Protein Information: high mobility group protein B2
• Protein Family: HMG2-induced ER-remodeling protein

NCBI Description

This gene encodes a member of the non-histone chromosomal high mobility group protein family. The proteins of this family are chromatin-associated and ubiquitously distributed in the nucleus of higher eukaryotic cells. In vitro studies have demonstrated that this protein is able to efficiently bend DNA and form DNA circles. These studies suggest a role in facilitating cooperative interactions between cis-acting proteins by promoting DNA flexibility. This protein was also reported to be involved in the final ligation step in DNA end-joining processes of DNA double-strand breaks repair and V(D)J recombination. [provided by RefSeq, Jul 2008]