Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged HLA-DQB1 is 0.3 ng/ml as a capture antibody.)

Mouse HLA-DQB1 Monoclonal Antibody | anti-HLA-DQB1 antibody

HLA-DQB1 (Major Histocompatibility Complex, Class II, DQ beta 1, CELIAC1, HLA-DQB, IDDM1) (APC)

Gene Names
HLA-DQB1; IDDM1; CELIAC1; HLA-DQB
Applications
Western Blot
Purity
Purified
Synonyms
HLA-DQB1; Monoclonal Antibody; HLA-DQB1 (Major Histocompatibility Complex; Class II; DQ beta 1; CELIAC1; HLA-DQB; IDDM1) (APC); Major Histocompatibility Complex; IDDM1; anti-HLA-DQB1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1G6
Specificity
Recognizes HLA-DQB1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
261
Applicable Applications for anti-HLA-DQB1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
HLA-DQB1 (AAH12106.1, 129aa-217aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQNPII
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged HLA-DQB1 is 0.3 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged HLA-DQB1 is 0.3 ng/ml as a capture antibody.)
Product Categories/Family for anti-HLA-DQB1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
HLA-DQB1 protein
NCBI Official Synonym Full Names
major histocompatibility complex, class II, DQ beta 1
NCBI Official Symbol
HLA-DQB1
NCBI Official Synonym Symbols
IDDM1; CELIAC1; HLA-DQB
NCBI Protein Information
HLA class II histocompatibility antigen, DQ beta 1 chain

NCBI Description

HLA-DQB1 belongs to the HLA class II beta chain paralogs. This class II molecule is a heterodimer consisting of an alpha (DQA) and a beta chain (DQB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and it contains six exons. Exon 1 encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. Within the DQ molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to four different molecules. Typing for these polymorphisms is routinely done for bone marrow transplantation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2011]

Research Articles on HLA-DQB1

Similar Products

Product Notes

The HLA-DQB1 (Catalog #AAA6169632) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's HLA-DQB1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HLA-DQB1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HLA-DQB1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.