Mouse HLA-A Monoclonal Antibody | anti-HLA-A antibody

HLA-A (Major Histocompatibility Complex, Class I, A, HLAA) (PE)

Cat. Num. AAA6187821

• Gene Names: HLA-A; HLAA
• Applications: Western Blot
• Purity: Purified
• Synonyms: HLA-A; Monoclonal Antibody; HLA-A (Major Histocompatibility Complex; Class I; A; HLAA) (PE); Major Histocompatibility Complex; HLAA; anti-HLA-A antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2D6
• Specificity: Recognizes HLA-A.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 365

• Applicable Applications for anti-HLA-A antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: HLA-A (AAH03069, 24aa-365aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: AGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASSDSAQGSDVSLTACKV
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged HLA-A is 3 ng/ml as a capture antibody.)

Western Blot (WB)

(HLA-A monoclonal antibody (M01), clone 2D6. Western Blot analysis of HLA-A expression in A-431.)

Western Blot (WB)

(Western Blot analysis of HLA-A expression in transfected 293T cell line by HLA-A monoclonal antibody (M01), clone 2D6.Lane 1: HLA-A transfected lysate (Predicted MW: 40.8 KDa).Lane 2: Non-transfected lysate.)

Related Product Information for anti-HLA-A antibody

HLA-A belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. Class I molecules play a central role in the immune system by presenting peptides derived from the endoplasmic reticulum lumen. They are expressed in nearly all cells. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon 1 encodes the leader peptide, exons 2 and 3 encode the alpha1 and alpha2 domains, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region, and exons 6 and 7 encode the cytoplasmic tail. Polymorphisms within exon 2 and exon 3 are responsible for the peptide binding specificity of each class one molecule. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. Hundreds of HLA-A alleles have been described. [provided by RefSeq]

Product Categories/Family for anti-HLA-A antibody

Antibodies; HLA

NCBI and Uniprot Product Information

• NCBI GI #: 13111764
• NCBI GeneID: 3105
• NCBI Official Full Name: HLA-A protein
• NCBI Official Synonym Full Names: major histocompatibility complex, class I, A
• NCBI Official Symbol: HLA-A
• NCBI Official Synonym Symbols: HLAA
• NCBI Protein Information: HLA class I histocompatibility antigen, A alpha chain
• Protein Family: HLA class I histocompatibility antigen

NCBI Description

HLA-A belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. Class I molecules play a central role in the immune system by presenting peptides derived from the endoplasmic reticulum lumen. They are expressed in nearly all cells. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon 1 encodes the leader peptide, exons 2 and 3 encode the alpha1 and alpha2 domains, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region, and exons 6 and 7 encode the cytoplasmic tail. Polymorphisms within exon 2 and exon 3 are responsible for the peptide binding specificity of each class one molecule. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. Hundreds of HLA-A alleles have been described. [provided by RefSeq, Jul 2008]