Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Immunoperoxidase of monoclonal antibody to HIPK2 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 1 ug/ml])

Mouse HIPK2 Monoclonal Antibody | anti-HIPK2 antibody

HIPK2 (Homeodomain Interacting Protein Kinase 2, DKFZp686K02111, FLJ23711, PRO0593) (AP)

Gene Names
HIPK2; PRO0593
Applications
Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
HIPK2; Monoclonal Antibody; HIPK2 (Homeodomain Interacting Protein Kinase 2; DKFZp686K02111; FLJ23711; PRO0593) (AP); Homeodomain Interacting Protein Kinase 2; PRO0593; anti-HIPK2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1F10
Specificity
Recognizes HIPK2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
1198
Applicable Applications for anti-HIPK2 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
HIPK2 (AAG41236.1, 961aa-1065aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TGNPRTIIVPPLKTQASEVLVECDSLVPVNTSHHSSSYKSKSSSNVTSTSGHSSGSSSGAITYRQQRPGPHFQQQQPLNLSQAQQHITTDRTGSHRRQQAYITPT
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to HIPK2 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 1 ug/ml])

Testing Data (Immunoperoxidase of monoclonal antibody to HIPK2 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 1 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to HIPK2 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 1 ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to HIPK2 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 1 ug/ml])

Western Blot (WB)

(HIPK2 monoclonal antibody (M03), clone 1F10 Western Blot analysis of HIPK2 expression in MES-SA/Dx5.)

Western Blot (WB) (HIPK2 monoclonal antibody (M03), clone 1F10 Western Blot analysis of HIPK2 expression in MES-SA/Dx5.)

Western Blot (WB)

(HIPK2 monoclonal antibody (M03), clone 1F10. Western Blot analysis of HIPK2 expression in RIN-m5F.)

Western Blot (WB) (HIPK2 monoclonal antibody (M03), clone 1F10. Western Blot analysis of HIPK2 expression in RIN-m5F.)

Testing Data

(Detection limit for recombinant GST tagged HIPK2 is approximately 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged HIPK2 is approximately 0.1ng/ml as a capture antibody.)
Related Product Information for anti-HIPK2 antibody
HIPK2 is a conserved serine/threonine nuclear kinase that interacts with homeodomain transcription factors. [supplied by OMIM]
Product Categories/Family for anti-HIPK2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
protein kinase HIPK2
NCBI Official Synonym Full Names
homeodomain interacting protein kinase 2
NCBI Official Symbol
HIPK2
NCBI Official Synonym Symbols
PRO0593
NCBI Protein Information
homeodomain-interacting protein kinase 2

NCBI Description

This gene encodes a conserved serine/threonine kinase that is a member of the homeodomain-interacting protein kinase family. The encoded protein interacts with homeodomain transcription factors and many other transcription factors such as p53, and can function as both a corepressor and a coactivator depending on the transcription factor and its subcellular localization. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2011]

Research Articles on HIPK2

Similar Products

Product Notes

The HIPK2 (Catalog #AAA6163102) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's HIPK2 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HIPK2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HIPK2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.