Mouse anti-Human HIP1 Monoclonal Antibody | anti-HIP1 antibody

HIP1 (Huntingtin-interacting Protein 1, Huntingtin-interacting Protein I, MGC126506) APC

Cat. Num. AAA6136976

• Gene Names: HIP1; SHON; HIP-I; ILWEQ; SHONbeta; SHONgamma
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: HIP1; Monoclonal Antibody; HIP1 (Huntingtin-interacting Protein 1; Huntingtin-interacting Protein I; MGC126506) APC; anti-HIP1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1F12
• Specificity: Recognizes human HIP1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-HIP1 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa928-1037 from human HIP1 (NP_005329) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: DSPNLAQLQQASRGVNQATAGVVASTISGKSQIEETDNMDFSSMTLTQIKRQEMDSQVRVLELENELQKERQKLGELRKKHYELAGVAEGWEEGTEASPPTLQEVVTEKE
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB)

(HIP1 monoclonal antibody Western Blot analysis of HIP1 expression in HeLa)

Western Blot (WB)

(Western Blot analysis of HIP1 expression in transfected 293T cell line by HIP1 monoclonal antibody Lane 1: HIP1 transfected lysate (116.2kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to HIP1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml])

Immunoprecipitation (IP)

(Immunoprecipitation of HIP1 transfected lysate using HIP1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with HIP1 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged HIP1 is ~0.3ng/ml as a capture antibody.)

Product Categories/Family for anti-HIP1 antibody

Antibodies; Disease Markers

NCBI and Uniprot Product Information

• NCBI GI #: 206729937
• NCBI GeneID: 3092
• NCBI Accession #: NP_005329
• NCBI GenBank Nucleotide #: NM_005338
• UniProt Accession #: O00291
• Molecular Weight: 114kDa
• NCBI Official Full Name: Huntingtin-interacting protein 1
• NCBI Official Synonym Full Names: huntingtin interacting protein 1
• NCBI Official Symbol: HIP1
• NCBI Official Synonym Symbols: SHON; HIP-I; ILWEQ; SHONbeta; SHONgamma
• NCBI Protein Information: huntingtin-interacting protein 1
• UniProt Protein Name: Huntingtin-interacting protein 1
• Protein Family: Histidine permease
• UniProt Gene Name: HIP1
• UniProt Synonym Gene Names: HIP-1; HIP-I
• UniProt Entry Name: HIP1_HUMAN

NCBI Description

The product of this gene is a membrane-associated protein that functions in clathrin-mediated endocytosis and protein trafficking within the cell. The encoded protein binds to the huntingtin protein in the brain; this interaction is lost in Huntington's disease. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]

Uniprot Description

HIP1: Plays a role in clathrin-mediated endocytosis and trafficking. Involved in regulating AMPA receptor trafficking in the central nervous system in an NMDA-dependent manner. Enhances androgen receptor (AR)-mediated transcription. May act as a proapoptotic protein that induces cell death by acting through the intrinsic apoptosis pathway. Binds 3-phosphoinositides (via ENTH domain). May act through the ENTH domain to promote cell survival by stabilizing receptor tyrosine kinases following ligand-induced endocytosis. May play a functional role in the cell filament networks. May be required for differentiation, proliferation, and/or survival of somatic and germline progenitors. A chromosomal aberration involving HIP1 is found in a form of chronic myelomonocytic leukemia (CMML). Translocation t(5;7)(q33;q11.2) with PDGFRB. The chimeric HIP1-PDGFRB transcript results from an in-frame fusion of the two genes. The reciprocal PDGFRB-HIP1 transcript is not expressed. Belongs to the SLA2 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cytoskeletal; Apoptosis

Chromosomal Location of Human Ortholog: 7q11.23

Cellular Component: Golgi apparatus; cytoskeleton; intracellular membrane-bound organelle; clathrin-coated vesicle; membrane; cytoplasm; clathrin coated vesicle membrane; nucleus

Molecular Function: protein binding, bridging; clathrin binding; protein binding; structural constituent of cytoskeleton; actin binding; phosphoinositide binding

Biological Process: regulation of apoptosis; caspase activation; clathrin cage assembly; transcription, DNA-dependent; regulation of transcription, DNA-dependent; apoptosis; endocytosis; cell differentiation; actin cytoskeleton organization and biogenesis; positive regulation of receptor-mediated endocytosis

Disease: Prostate Cancer