Western Blot (WB)
(Western Blot detection against Immunogen (64.5kD).)
Mouse anti-Human HIF1AN Monoclonal Antibody | anti-HIF1AN antibody
HIF1AN (Hypoxia Inducible Factor 1 alpha Inhibitor, DKFZp762F1811, Factor Inhibiting HIF1, FIH1, FLJ20615, FLJ22027, Hypoxia Inducible Factor Asparagine Hydroxylase, Prolyl Hydroxylase) (AP)
Gene Names
HIF1AN; FIH1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HIF1AN; Monoclonal Antibody; HIF1AN (Hypoxia Inducible Factor 1 alpha Inhibitor; DKFZp762F1811; Factor Inhibiting HIF1; FIH1; FLJ20615; FLJ22027; Hypoxia Inducible Factor Asparagine Hydroxylase; Prolyl Hydroxylase) (AP); anti-HIF1AN antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1D8
Specificity
Recognizes human HIF1AN.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-HIF1AN antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-350 from human HIF1AN (AAH07719) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (64.5kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (64.5kD).)
Western Blot (WB)
(HIF1AN monoclonal antibody, Western Blot analysis of HIF1AN expression in Jurkat.)
Western Blot (WB)
(HIF1AN monoclonal antibody, Western Blot analysis of HIF1AN expression in Jurkat.)
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to HIF1AN on HeLa cell. [antibody concentration 10ug/ml].)
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to HIF1AN on HeLa cell. [antibody concentration 10ug/ml].)
Product Categories/Family for anti-HIF1AN antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
40,285 Da
NCBI Official Full Name
Homo sapiens hypoxia inducible factor 1, alpha subunit inhibitor, mRNA
NCBI Official Synonym Full Names
hypoxia inducible factor 1 alpha subunit inhibitor
NCBI Official Symbol
HIF1AN
NCBI Official Synonym Symbols
FIH1
NCBI Protein Information
hypoxia-inducible factor 1-alpha inhibitor
Protein Family
Research Articles on HIF1AN
Similar Products
Product Notes
The HIF1AN (Catalog #AAA6131670) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HIF1AN (Hypoxia Inducible Factor 1 alpha Inhibitor, DKFZp762F1811, Factor Inhibiting HIF1, FIH1, FLJ20615, FLJ22027, Hypoxia Inducible Factor Asparagine Hydroxylase, Prolyl Hydroxylase) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HIF1AN can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HIF1AN for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HIF1AN, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
