Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (32.38kD).)

Mouse anti-Human, Rat HIC1 Monoclonal Antibody | anti-HIC1 antibody

HIC1 (Hypermethylated in Cancer 1 Protein, Hic-1, Zinc Finger and BTB Domain-containing Protein 29, ZBTB29) (AP)

Gene Names
HIC1; hic-1; ZBTB29; ZNF901
Reactivity
Human, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HIC1; Monoclonal Antibody; HIC1 (Hypermethylated in Cancer 1 Protein; Hic-1; Zinc Finger and BTB Domain-containing Protein 29; ZBTB29) (AP); anti-HIC1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4E11
Specificity
Recognizes human HIC1. Species Crossreactivity: rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-HIC1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa396-453 from human HIC1 (NP_006488) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
YKSSSEETGSSEDPSPPGGHLEGYPCPHLAYGEPESFGDNLYVCIPCGKGFPSSEQLN
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (32.38kD).)

Western Blot (WB) (Western Blot detection against Immunogen (32.38kD).)

Western Blot (WB)

(HIC1 monoclonal antibody Western Blot analysis of HIC1 expression in PC-12)

Western Blot (WB) (HIC1 monoclonal antibody Western Blot analysis of HIC1 expression in PC-12)

Western Blot (WB)

(HIC1 monoclonal antibody Western Blot analysis of HIC1 expression in Jurkat.)

Western Blot (WB) (HIC1 monoclonal antibody Western Blot analysis of HIC1 expression in Jurkat.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to HIC1 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to HIC1 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged HIC1 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged HIC1 is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-HIC1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
74kDa
NCBI Official Full Name
hypermethylated in cancer 1 protein isoform 1
NCBI Official Synonym Full Names
HIC ZBTB transcriptional repressor 1
NCBI Official Symbol
HIC1
NCBI Official Synonym Symbols
hic-1; ZBTB29; ZNF901
NCBI Protein Information
hypermethylated in cancer 1 protein
UniProt Protein Name
Hypermethylated in cancer 1 protein
UniProt Gene Name
HIC1
UniProt Synonym Gene Names
ZBTB29; Hic-1
UniProt Entry Name
HIC1_HUMAN

NCBI Description

This gene functions as a growth regulatory and tumor repressor gene. Hypermethylation or deletion of the region of this gene have been associated with tumors and the contiguous-gene syndrome, Miller-Dieker syndrome. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Sep 2010]

Uniprot Description

HIC1: Transcriptional repressor. Recognizes and binds to the consensus sequence '5-[CG]NG[CG]GGGCA[CA]CC-3'. May act as a tumor suppressor. May be involved in development of head, face, limbs and ventral body wall. Involved in down-regulation of SIRT1 and thereby is involved in regulation of p53/TP53-dependent apoptotic DNA-damage responses. The specific target gene promoter association seems to be depend on corepressors, such as CTBP1 or CTBP2 and MTA1. The regulation of SIRT1 transcription in response to nutrient deprivation seems to involve CTBP1. In cooperation with MTA1 (indicative for an association with the NuRD complex) represses transcription from CCND1/cyclin-D1 and CDKN1C/p57Kip2 specifically in quiescent cells. Involved in regulation of the Wnt signaling pathway probably by association with TCF7L2 and preventing TCF7L2 and CTNNB1 association with promoters of TCF- responsive genes. Seems to repress transcription from E2F1 and ATOH1 which involves ARID1A, indicative for the participation of a distinct SWI/SNF-type chromatin-remodeling complex. Probably represses transcription from CXCR7, FGFBP1 and EFNA1. Belongs to the krueppel C2H2-type zinc-finger protein family. Hic subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor; Tumor suppressor; C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 17p13.3

Cellular Component: nucleoplasm; cytoplasm; chromatin

Molecular Function: protein binding; sequence-specific DNA binding; metal ion binding; histone deacetylase binding; transcription factor activity

Biological Process: negative regulation of Wnt receptor signaling pathway; Wnt receptor signaling pathway; regulation of transcription, DNA-dependent; DNA damage response, signal transduction resulting in induction of apoptosis; transcription, DNA-dependent; multicellular organismal development; positive regulation of DNA damage response, signal transduction by p53 class mediator; negative regulation of transcription from RNA polymerase II promoter

Research Articles on HIC1

Similar Products

Product Notes

The HIC1 hic1 (Catalog #AAA6131668) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HIC1 (Hypermethylated in Cancer 1 Protein, Hic-1, Zinc Finger and BTB Domain-containing Protein 29, ZBTB29) (AP) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HIC1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HIC1 hic1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HIC1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.