Mouse anti-Human HHIP Monoclonal Antibody | anti-HHIP antibody

HHIP (Hedgehog-interacting Protein, HHIP, HIP, UNQ5825/PRO19644, FLJ20992, FLJ90230) (HRP)

Cat. Num. AAA6152878

• Gene Names: HHIP; HIP
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: HHIP; Monoclonal Antibody; HHIP (Hedgehog-interacting Protein; HIP; UNQ5825/PRO19644; FLJ20992; FLJ90230) (HRP); anti-HHIP antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 5D11
• Specificity: Recognizes human HHIP.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-HHIP antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa21-121 from human HHIP (NP_071920) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: GDAKFGERNEGSGARRRRCLNGNPPKRLKRRDRRMMSQLELLSGGEMLCGGFYPRLSCCLRSDSPGLGRLENKIFSVTNNTECGKLLEEIKCALCSPHSQ
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(Western Blot analysis of HHIP expression in transfected 293T cell line by HHIP monoclonal antibody. Lane 1: HHIP transfected lysate (78.9kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to HHIP on formalin-fixed paraffin-embedded human heart. [antibody concentration 3ug/ml].)

Immunoprecipitation (IP)

(Immunoprecipitation of HHIP transfected lysate using HHIP monoclonal antibody and Protein A Magnetic Bead and immunoblotted with HHIP rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged HHIP is ~1ng/ml as a capture antibody.)

Western Blot (WB)

(HHIP monoclonal antibody, Western Blot analysis of HHIP expression in Hela NE.)

Western Blot (WB)

(HHIP monoclonal antibody. Western Blot analysis of HHIP expression in MCF-7.)

Product Categories/Family for anti-HHIP antibody

Antibodies; Sonic Hedgehog (SHH)

NCBI and Uniprot Product Information

• NCBI GI #: 20143973
• NCBI GeneID: 64399
• NCBI Accession #: NP_071920
• NCBI GenBank Nucleotide #: NM_022475
• UniProt Accession #: Q96QV1; Q6PK09; Q8NCI7; Q9BXK3; Q9H1J4; Q9H7E7
• Molecular Weight: 36,373 Da
• NCBI Official Full Name: hedgehog-interacting protein
• NCBI Official Synonym Full Names: hedgehog interacting protein
• NCBI Official Symbol: HHIP
• NCBI Official Synonym Symbols: HIP
• NCBI Protein Information: hedgehog-interacting protein
• UniProt Protein Name: Hedgehog-interacting protein
• Protein Family: HHIP-like protein
• UniProt Gene Name: HHIP
• UniProt Synonym Gene Names: HIP; HHIP; HIP
• UniProt Entry Name: HHIP_HUMAN

Uniprot Description

HHIP: Modulates hedgehog signaling in several cell types including brain and lung through direct interaction with members of the hedgehog family. Belongs to the HHIP family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell development/differentiation; Membrane protein, integral

Chromosomal Location of Human Ortholog: 4q28-q32

Cellular Component: cell surface; integral to plasma membrane; cytoplasm; extracellular region

Molecular Function: protein binding; oxidoreductase activity, acting on the CH-OH group of donors, quinone or similar compound as acceptor; zinc ion binding; quinone binding

Biological Process: smoothened signaling pathway; dorsal/ventral pattern formation; skeletal morphogenesis; negative regulation of smoothened signaling pathway; neuroblast proliferation; carbohydrate metabolic process; regulation of fibroblast growth factor receptor signaling pathway; negative regulation of signal transduction