Western Blot (WB)
(HEYL monoclonal antibody (M16), clone 3B11 Western Blot analysis of HEYL expression in SW-13.)
Mouse HEYL Monoclonal Antibody | anti-HEYL antibody
HEYL (Hairy/Enhancer-of-Split Related with YRPW Motif-like, HRT3, MGC12623, bHLHb33) (Biotin)
Gene Names
HEYL; HEY3; HRT3; HESR3; bHLHb33
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
HEYL; Monoclonal Antibody; HEYL (Hairy/Enhancer-of-Split Related with YRPW Motif-like; HRT3; MGC12623; bHLHb33) (Biotin); Hairy/Enhancer-of-Split Related with YRPW Motif-like; bHLHb33; anti-HEYL antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3B11
Specificity
Recognizes HEYL.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-HEYL antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
HEYL (NP_055386, 1aa-70aa) full length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MKRPKEPSGSDGESDGPIDVGQEGQLSQMARPLSTPSSSQMQARKKRRGIIEKRRRDRINSSLSELRRLV
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(HEYL monoclonal antibody (M16), clone 3B11 Western Blot analysis of HEYL expression in SW-13.)
Western Blot (WB)
(HEYL monoclonal antibody (M16), clone 3B11 Western Blot analysis of HEYL expression in SW-13.)
Related Product Information for anti-HEYL antibody
This gene encodes a member of the hairy and enhancer of split-related (HESR) family of basic helix-loop-helix (bHLH)-type transcription factors. The sequence of the encoded protein contains a conserved bHLH and orange domain, but its YRPW motif has diverged from other HESR family members. It is thought to be an effector of Notch signaling and a regulator of cell fate decisions. Alternatively spliced transcript variants have been found, but their biological validity has not been determined. [provided by RefSeq]
Product Categories/Family for anti-HEYL antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
35,087 Da
NCBI Official Full Name
hairy/enhancer-of-split related with YRPW motif-like protein
NCBI Official Synonym Full Names
hes-related family bHLH transcription factor with YRPW motif-like
NCBI Official Symbol
HEYL
NCBI Official Synonym Symbols
HEY3; HRT3; HESR3; bHLHb33
NCBI Protein Information
hairy/enhancer-of-split related with YRPW motif-like protein; HEY-like protein; HRT-3; class B basic helix-loop-helix protein 33; hHRT3; hHeyL; hairy-related transcription factor 3; hairy/enhancer-of-split related with YRPW motif 3
UniProt Protein Name
Hairy/enhancer-of-split related with YRPW motif-like protein
Protein Family
UniProt Gene Name
HEYL
UniProt Synonym Gene Names
BHLHB33; HRT3; hHeyL; bHLHb33; HRT-3; hHRT3
UniProt Entry Name
HEYL_HUMAN
Similar Products
Product Notes
The HEYL heyl (Catalog #AAA6171474) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's HEYL can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HEYL heyl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HEYL, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
