Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of HEY1 expression in transfected 293T cell line by HEY1 monoclonal antibody (M03), clone 1B9.Lane 1: HEY1 transfected lysate (32.613 KDa).Lane 2: Non-transfected lysate.)

Mouse HEY1 Monoclonal Antibody | anti-HEY1 antibody

HEY1 (Hairy/Enhancer-of-Split Related with YRPW Motif 1, BHLHb31, CHF2, HERP2, HESR1, HRT-1, MGC1274, OAF1) (AP)

Gene Names
HEY1; CHF2; OAF1; HERP2; HESR1; HRT-1; hHRT1; BHLHb31
Applications
Western Blot
Purity
Purified
Synonyms
HEY1; Monoclonal Antibody; HEY1 (Hairy/Enhancer-of-Split Related with YRPW Motif 1; BHLHb31; CHF2; HERP2; HESR1; HRT-1; MGC1274; OAF1) (AP); Hairy/Enhancer-of-Split Related with YRPW Motif 1; OAF1; anti-HEY1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1B9
Specificity
Recognizes HEY1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-HEY1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
HEY1 (NP_036390, 121aa-220aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGRLG
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of HEY1 expression in transfected 293T cell line by HEY1 monoclonal antibody (M03), clone 1B9.Lane 1: HEY1 transfected lysate (32.613 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of HEY1 expression in transfected 293T cell line by HEY1 monoclonal antibody (M03), clone 1B9.Lane 1: HEY1 transfected lysate (32.613 KDa).Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged HEY1 is approximately 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged HEY1 is approximately 0.1ng/ml as a capture antibody.)
Related Product Information for anti-HEY1 antibody
This gene encodes a nuclear protein belonging to the hairy and enhancer of split-related (HESR) family of basic helix-loop-helix (bHLH)-type transcriptional repressors. Expression of this gene is induced by the Notch and c-Jun signal transduction pathways. Two similar and redundant genes in mouse are required for embryonic cardiovascular development, and are also implicated in neurogenesis and somitogenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq]
Product Categories/Family for anti-HEY1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33,100 Da
NCBI Official Full Name
hairy/enhancer-of-split related with YRPW motif protein 1 isoform a
NCBI Official Synonym Full Names
hes-related family bHLH transcription factor with YRPW motif 1
NCBI Official Symbol
HEY1
NCBI Official Synonym Symbols
CHF2; OAF1; HERP2; HESR1; HRT-1; hHRT1; BHLHb31
NCBI Protein Information
hairy/enhancer-of-split related with YRPW motif protein 1; HES-related repressor protein 1; HES-related repressor protein 2; basic helix-loop-helix protein OAF1; cardiovascular helix-loop-helix factor 2; class B basic helix-loop-helix protein 31; hairy an
UniProt Protein Name
Hairy/enhancer-of-split related with YRPW motif protein 1
UniProt Gene Name
HEY1
UniProt Synonym Gene Names
BHLHB31; CHF2; HERP2; HESR1; HRT1; CHF-2; bHLHb31; HESR-1; HRT-1; hHRT1
UniProt Entry Name
HEY1_HUMAN

Similar Products

Product Notes

The HEY1 hey1 (Catalog #AAA6163169) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's HEY1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HEY1 hey1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HEY1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.