Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to HES1 on HeLa cell. [antibody concentration 10 ug/ml])
Mouse HES1 Monoclonal Antibody | anti-HES1 antibody
HES1 (Hairy and Enhancer of Split 1, (Drosophila), FLJ20408, HES-1, HHL, HRY, bHLHb39) (FITC)
Gene Names
HES1; HHL; HRY; HES-1; bHLHb39
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
HES1; Monoclonal Antibody; HES1 (Hairy and Enhancer of Split 1; (Drosophila); FLJ20408; HES-1; HHL; HRY; bHLHb39) (FITC); Hairy and Enhancer of Split 1; bHLHb39; anti-HES1 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3A3
Specificity
Recognizes HES1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-HES1 antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
HES1 (NP_005515, 36aa-142aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGH
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.
FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to HES1 on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to HES1 on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to HES1 on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to HES1 on HeLa cell. [antibody concentration 10 ug/ml])
Western Blot (WB)
(HES1 monoclonal antibody (M02), clone 3A3. Western Blot analysis of HES1 expression in H9c2 (2-1).)
Western Blot (WB)
(HES1 monoclonal antibody (M02), clone 3A3. Western Blot analysis of HES1 expression in H9c2 (2-1).)
Related Product Information for anti-HES1 antibody
This protein belongs to the basic helix-loop-helix family of transcription factors. It is a transcriptional repressor of genes that require a bHLH protein for their transcription. The protein has a particular type of basic domain that contains a helix interrupting protein that binds to the N-box rather than the canonical E-box. [provided by RefSeq]
Product Categories/Family for anti-HES1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
29,541 Da
NCBI Official Full Name
transcription factor HES-1
NCBI Official Synonym Full Names
hes family bHLH transcription factor 1
NCBI Official Symbol
HES1
NCBI Official Synonym Symbols
HHL; HRY; HES-1; bHLHb39
NCBI Protein Information
transcription factor HES-1; class B basic helix-loop-helix protein 39; hairy homolog; hairy-like protein
UniProt Protein Name
Transcription factor HES-1
Protein Family
UniProt Gene Name
HES1
UniProt Synonym Gene Names
BHLHB39; HL; HRY; bHLHb39; hHL
UniProt Entry Name
HES1_HUMAN
Similar Products
Product Notes
The HES1 hes1 (Catalog #AAA6175409) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's HES1 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HES1 hes1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HES1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
