Mouse anti-Human HDAC5 Monoclonal Antibody | anti-HDAC5 antibody

HDAC5 (HD5, FLJ90614, KIAA0600, Antigen NY-CO-9, Histone Deacetylase 5) (HRP)

Cat. Num. AAA6152848

• Gene Names: HDAC5; HD5; NY-CO-9
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: HDAC5; Monoclonal Antibody; HDAC5 (HD5; FLJ90614; KIAA0600; Antigen NY-CO-9; Histone Deacetylase 5) (HRP); anti-HDAC5 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 4G2
• Specificity: Recognizes human HDAC5.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 3675

• Applicable Applications for anti-HDAC5 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa330-429 from HDAC5 (AAH51824) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: AENGFTGSVPNIPTEMLPQHRALPLDSSPNQFSLYTSPSLPNISLGLQATVTVTNSHLTASPKLSTQQEAERQALQSLRQGGTLTGKFMSTSSIPGCLLG
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB)

(HDAC5 monoclonal antibody Western Blot analysis of HDAC5 expression in COLO 320 HSR.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to HDAC5 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged HDAC5 is ~0.1ng/ml as a capture antibody.)

Related Product Information for anti-HDAC5 antibody

Human HDAC5 is composed of 1122aa residues. The deacetylase domain of HDAC5 is located at the C-terminal half of the molecule. The N-terminal non-deacetylase domain does not show any significant homology with any published sequence. Both domains are required for HDAC5-mediated repression of gene transcription. HDAC5 interacts with a growing number of transcriptional factors including MEF2A as well as other HDAC proteins. The interacting complexes bind to specific regions of chromatin and regulate gene transcription in these regions.

Product Categories/Family for anti-HDAC5 antibody

Antibodies; Enzymes; Deacetylase

NCBI and Uniprot Product Information

• NCBI GI #: 30353987
• NCBI GeneID: 10014
• NCBI Official Full Name: Homo sapiens histone deacetylase 5, mRNA
• NCBI Official Synonym Full Names: histone deacetylase 5
• NCBI Official Symbol: HDAC5
• NCBI Official Synonym Symbols: HD5; NY-CO-9
• NCBI Protein Information: histone deacetylase 5

NCBI Description

Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to the class II histone deacetylase/acuc/apha family. It possesses histone deacetylase activity and represses transcription when tethered to a promoter. It coimmunoprecipitates only with HDAC3 family member and might form multicomplex proteins. It also interacts with myocyte enhancer factor-2 (MEF2) proteins, resulting in repression of MEF2-dependent genes. This gene is thought to be associated with colon cancer. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]