Mouse HDAC1 Monoclonal Antibody | anti-HDAC1 antibody

HDAC1 (Histone Deacetylase 1, HD1, HD-1, HDAC1, HDAC-1, RPD3, RPD3L1, Reduced Potassium Dependency 3 Like-1) (AP)

Cat. Num. AAA6131632

• Gene Names: HDAC1; HD1; RPD3; GON-10; RPD3L1
• Reactivity: Human, Mouse, Rat
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: HDAC1; Monoclonal Antibody; HDAC1 (Histone Deacetylase 1; HD1; HD-1; HDAC-1; RPD3; RPD3L1; Reduced Potassium Dependency 3 Like-1) (AP); anti-HDAC1 antibody

• Host: Mouse
• Reactivity: Human, Mouse, Rat
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 5C11
• Specificity: Recognizes human HDAC1. Species Crossreactivity: mouse and rat.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-HDAC1 antibody: ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-482 from human HDAC1 (AAH00301) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (78.76kD).)

Western Blot (WB)

(HDAC1 monoclonal antibody. Western Blot analysis of HDAC1 expression in PC-12)

Western Blot (WB)

(HDAC1 monoclonal antibody Western Blot analysis of HDAC1 expression in Hela NE)

Western Blot (WB)

(HDAC1 monoclonal antibody Western Blot analysis of HDAC1 expression in Raw 264.7)

Western Blot (WB)

(HDAC1 monoclonal antibody Western Blot analysis of HDAC1 expression in NIH/3T3)

Western Blot (WB)

(Western Blot analysis of HDAC1 expression in transfected 293T cell line by HDAC1 monoclonal antibody Lane 1: HDAC1 transfected lysate (55.1kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to HDAC1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3ug/ml])

Product Categories/Family for anti-HDAC1 antibody

Antibodies; Enzymes; Deacetylase

NCBI and Uniprot Product Information

• NCBI GI #: 38197109
• NCBI GeneID: 3065
• Molecular Weight: 55,103 Da
• NCBI Official Full Name: Homo sapiens histone deacetylase 1, mRNA
• NCBI Official Synonym Full Names: histone deacetylase 1
• NCBI Official Symbol: HDAC1
• NCBI Official Synonym Symbols: HD1; RPD3; GON-10; RPD3L1
• NCBI Protein Information: histone deacetylase 1

NCBI Description

Histone acetylation and deacetylation, catalyzed by multisubunit complexes, play a key role in the regulation of eukaryotic gene expression. The protein encoded by this gene belongs to the histone deacetylase/acuc/apha family and is a component of the histone deacetylase complex. It also interacts with retinoblastoma tumor-suppressor protein and this complex is a key element in the control of cell proliferation and differentiation. Together with metastasis-associated protein-2, it deacetylates p53 and modulates its effect on cell growth and apoptosis. [provided by RefSeq, Jul 2008]