Mouse HDAC1 Monoclonal Antibody | anti-HDAC1 antibody

HDAC1 (Histone Deacetylase 1, DKFZp686H12203, GON-10, HD1, RPD3, RPD3L1) (HRP)

Cat. Num. AAA6179620

• Gene Names: HDAC1; HD1; RPD3; KDAC1; GON-10; RPD3L1
• Applications: Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified
• Synonyms: HDAC1; Monoclonal Antibody; HDAC1 (Histone Deacetylase 1; DKFZp686H12203; GON-10; HD1; RPD3; RPD3L1) (HRP); Histone Deacetylase 1; RPD3L1; anti-HDAC1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 5A11
• Specificity: Recognizes HDAC1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 482

• Applicable Applications for anti-HDAC1 antibody: Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: HDAC1 (AAH00301, 1aa-482aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to HDAC1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to HDAC1 on HeLa cell. [antibody concentration 10 ug/ml])

Western Blot (WB)

(HDAC1 monoclonal antibody (M11), clone 5A11 Western Blot analysis of HDAC1 expression in Hela S3 NE (Cat # L013V3).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to HDAC1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 0.7 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to HDAC1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 0.7 ug/ml])

Testing Data

(Detection limit for recombinant GST tagged HDAC1 is approximately 1ng/ml as a capture antibody.)

Product Categories/Family for anti-HDAC1 antibody

Antibodies; Enzymes; Deacetylase

NCBI and Uniprot Product Information

• NCBI GI #: 12653071
• NCBI GeneID: 3065
• NCBI Official Full Name: Histone deacetylase 1
• NCBI Official Synonym Full Names: histone deacetylase 1
• NCBI Official Symbol: HDAC1
• NCBI Official Synonym Symbols: HD1; RPD3; KDAC1; GON-10; RPD3L1
• NCBI Protein Information: histone deacetylase 1

NCBI Description

Histone acetylation and deacetylation, catalyzed by multisubunit complexes, play a key role in the regulation of eukaryotic gene expression. The protein encoded by this gene belongs to the histone deacetylase/acuc/apha family and is a component of the histone deacetylase complex. It also interacts with retinoblastoma tumor-suppressor protein and this complex is a key element in the control of cell proliferation and differentiation. Together with metastasis-associated protein-2, it deacetylates p53 and modulates its effect on cell growth and apoptosis. [provided by RefSeq, Jul 2008]